KEGG   Methanoregula boonei: Mboo_0586Help
Entry
Mboo_0586         CDS       T00578                                 

Definition
(GenBank) Methyl-coenzyme M reductase, beta subunit
  KO
K00401  methyl-coenzyme M reductase beta subunit [EC:2.8.4.1]
Organism
mbn  Methanoregula boonei
Pathway
mbn00680  Methane metabolism
mbn01100  Metabolic pathways
mbn01120  Microbial metabolism in diverse environments
mbn01200  Carbon metabolism
Module
mbn_M00357  Methanogenesis, acetate => methane
mbn_M00567  Methanogenesis, CO2 => methane
mbn_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mbn00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Mboo_0586
Enzymes [BR:mbn01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.4  Transferring alkylthio groups
    2.8.4.1  coenzyme-B sulfoethylthiotransferase
     Mboo_0586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCR_beta MCR_beta_N
Motif
Other DBs
NCBI-ProteinID: ABS55104
UniProt: A7I5U3
Position
complement(554836..556149)
Genome map
AA seq 437 aa AA seqDB search
MAKYKDTIDLYDDEGKLLKSNVTIDKISPLTNKGALELIDLTKRTVAVNLGGIEEALKTG
KMGGKSNQILGRGLNYSIVKDADAISAKIKDMIQVTDGDNTKITKIGGGKMLLVEVPSSR
INASATYDATSTSVASATTYALIDQYKVNMFDGSYVKGAVWGTYPQTMDMQGGNVVSILS
IPQNNEGLGYALRNIPANHAVMMTHRNAMQGAALSATFEQAGEFEMGAAIGPFERAQLLL
YAYQGLNANNIVYDLVKKNGKTGTIGTVVQSLVERAIEDKVIKAGKKGKSGYIFYDTKDP
MLWNAYASAGTLAATMVNCGAGRFAQAVSATLLYFNDLLEHETGLPGSDFGRAMGVAVGF
SFFSHSIYGGGGPGGFNGNHVVTRHAAGVGMPCIVAACALDAGTQMFGPEATSKVYQDTF
GQIDAFKRPIQTIAKGV
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatacaaggatacgattgacctctacgacgatgagggtaagctcttaaagagc
aacgtcacgatcgataagatcagcccgctgaccaacaagggagcgcttgagcttatcgac
ctcaccaagaggaccgtggcagtcaacctcggcggtatcgaggaagcactcaagaccgga
aagatgggcggcaagtccaaccagattctcggccgtggcctgaactacagcattgtcaag
gatgccgacgcaatttcagccaagatcaaggacatgatccaggtcaccgacggtgacaac
accaagatcaccaagatcggcggcggaaagatgcttctcgttgaagtcccgtcttcacgt
atcaacgcatcagcaacctacgatgcaacctcgacctctgtggcatccgcaaccacctac
gcactgattgaccagtacaaggtcaacatgttcgatggttcctatgtcaagggtgcagtc
tggggtacctacccgcagaccatggacatgcagggcggcaacgtcgtttctatcctgtcc
atcccccagaacaacgaaggtctcggctatgcactccgtaacatcccggccaaccacgcg
gtcatgatgacccaccggaatgcaatgcagggtgcagcactttcggctacctttgagcag
gccggagagttcgagatgggcgcagcaatcggcccgttcgagcgtgcacagctcctgctc
tacgcataccagggcttaaacgcaaacaacatcgtctacgacctcgtcaagaagaacggc
aagaccggtaccatcggtactgtcgtgcagagcctcgtcgagcgtgccattgaggacaag
gtcatcaaggcaggcaagaagggcaagagcggctatatcttctacgacaccaaggacccg
atgctgtggaacgcctacgcctcggcaggtacccttgccgcaaccatggtcaactgtggt
gcgggacggtttgcccaggcagtatccgcaaccctgctctacttcaacgacctgctcgag
cacgagaccggcctgcccggctctgacttcggccgtgcaatgggtgtagcagtcggattc
tcattcttcagccactcgatctacggcggtggcggccccggtggattcaacggtaaccac
gtcgttacccgtcacgcagccggtgtcggtatgccctgtatcgtcgcagcatgcgccctt
gatgcaggcacccagatgtttggccccgaggccacatccaaggtctaccaggacacattc
ggtcagattgacgcgttcaagagaccgattcagaccatcgcaaagggtgtataa

DBGET integrated database retrieval system