KEGG   Methanoregula boonei: Mboo_0599Help
Entry
Mboo_0599         CDS       T00578                                 

Definition
(GenBank) 3-isopropylmalate dehydratase
  KO
K16792  methanogen homoaconitase large subunit [EC:4.2.1.114]
Organism
mbn  Methanoregula boonei
Pathway
mbn00300  Lysine biosynthesis
mbn00680  Methane metabolism
mbn01100  Metabolic pathways
mbn01120  Microbial metabolism in diverse environments
mbn01130  Biosynthesis of antibiotics
mbn01210  2-Oxocarboxylic acid metabolism
mbn01230  Biosynthesis of amino acids
Module
mbn_M00608  2-Oxocarboxylic acid chain extension, 2-oxoglutarate => 2-oxoadipate => 2-oxopimelate => 2-oxosuberate
Brite
KEGG Orthology (KO) [BR:mbn00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Mboo_0599
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Mboo_0599
Enzymes [BR:mbn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.114  methanogen homoaconitase
     Mboo_0599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase DUF521
Motif
Other DBs
NCBI-ProteinID: ABS55117
UniProt: A7I5V6
Position
568558..569769
Genome map
AA seq 403 aa AA seqDB search
MSTLSERILGAAAGEYVDRKVDRAYAHDGTGVLALEAWKEMGRDRMGKETGYYIQFDHIA
PANNGLTATLQHELRNFAKRSSMHFSDVGCGICHQLMAEGEVLPGEIAVGADSHTVMLGA
FGAFATGVGATDMAAIWLTGETWFRVPESVGIHLTGNLTGAAEAKDLALAYVGKLGTDGA
TYQALEFIGEGVRHLSMDERFVLSNLSVEAGAKAGLFYADEVTLRYLKEHGLDTVSQEYE
SCSYCRELDFDLTDIVPLVSVPHRVDTVKPADAVAGVPLDQVFVGTCTNGRYSDLARFAR
LVKGKKVAVRTLVVPASAAILEKAIRTGVLADIVAAGCTIGTPGCGPCLGYHMGVLGEGE
ICLSTANRNFKNRMGVGAEIYLGSVATAAASALVGEIASPEVG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccttgtctgaacggattcttggtgctgccgcaggtgaatatgttgaccggaag
gttgaccgggcctatgcccacgacggaaccggtgtccttgccctggaagcctggaaagag
atgggaagagaccggatgggaaaggagaccggatattatatccagttcgatcatatcgcc
ccggccaataatggccttactgcaaccctccagcatgaactgcgaaattttgcaaagcgc
tcatccatgcatttctctgatgtcgggtgcggtatctgccaccagctgatggctgaaggg
gaggtcctgcccggcgagatcgcggtcggggcggactcgcacaccgttatgctgggggca
ttcggggcgtttgcgaccggtgtgggggcaaccgacatggcggcaatctggctgaccggg
gagacctggtttcgggtccccgaatctgtgggtatccacctgaccgggaatctgaccggt
gccgctgaagcaaaagaccttgcgcttgcctacgtgggaaaactcggtactgacggcgca
acctaccaggcgctggaatttatcggtgaaggggtacgtcatctctccatggatgaacgg
tttgtcctctcgaatctctcggttgaggccggggcaaaggccgggcttttttatgctgat
gaggtgaccctccgttacctcaaggagcacggactggatacggtaagtcaggaatatgag
tcatgttcgtactgccgggagcttgattttgatctcaccgacatcgtaccgctggtatcc
gtcccgcaccgggtggacaccgtcaaacccgcggacgccgttgccggcgtgcctcttgac
caggtctttgtcgggacctgcacgaacgggcggtactccgatcttgcccggtttgcccgg
cttgtgaagggaaagaaagtggcggtccggacccttgttgtcccggcatcggcagcaatc
ctggaaaaggcaatccgtaccggggtgcttgcagatatcgttgcggcagggtgcaccatt
ggaacaccgggatgcggcccctgtcttggctaccacatgggcgtgcttggcgaaggagag
atctgtctctcgactgccaaccggaatttcaagaaccgcatgggcgtaggcgctgagatt
tacctgggctctgttgctactgcagcggcgagcgcccttgtcggggagatcgcgtcacct
gaggtgggataa

DBGET integrated database retrieval system