KEGG   Methanoregula boonei: Mboo_0714Help
Entry
Mboo_0714         CDS       T00578                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mbn  Methanoregula boonei
Pathway
mbn00010  Glycolysis / Gluconeogenesis
mbn00030  Pentose phosphate pathway
mbn00051  Fructose and mannose metabolism
mbn00052  Galactose metabolism
mbn00230  Purine metabolism
mbn00500  Starch and sucrose metabolism
mbn00520  Amino sugar and nucleotide sugar metabolism
mbn00521  Streptomycin biosynthesis
mbn01100  Metabolic pathways
mbn01110  Biosynthesis of secondary metabolites
mbn01120  Microbial metabolism in diverse environments
mbn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mboo_0714
   00030 Pentose phosphate pathway
    Mboo_0714
   00051 Fructose and mannose metabolism
    Mboo_0714
   00052 Galactose metabolism
    Mboo_0714
   00500 Starch and sucrose metabolism
    Mboo_0714
   00520 Amino sugar and nucleotide sugar metabolism
    Mboo_0714
  Nucleotide metabolism
   00230 Purine metabolism
    Mboo_0714
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mboo_0714
Enzymes [BR:mbn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Mboo_0714
    5.4.2.8  phosphomannomutase
     Mboo_0714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ABS55232
UniProt: A7I671
Position
complement(680287..681669)
Genome map
AA seq 460 aa AA seqDB search
MAAEKIQKQLFGTNGVRGIAGTEITPDLALAIGKVLGTMRPGRIAVGRDTRTTGPALANA
LKAGLLATGCRVIDCGVLPTPALQYIIKEHYDGGAMITASHNPPEYNGVKIIEPDGTEMG
DEETVRLEHLLSKNSTPVKLWSEVGTETAAPNLIEEYVEAVVRHFTGKPGSGMTVIVDPG
SGPACQTTPAILQALGCRVLTINGVMDGTFPGRLPEPSPEGLANLAALVKANNAAFGVAH
DGDADRAVFVDNKGNFVEENHEFALIAQYICRNAKGAIVTPVSTSQLVEQVANAEGCTVQ
YTPVGSIYVARKMRELIDSGISVVFGGEGNGGLIFPDHQFCRDGGMTAASMVFLLSLSNQ
NLSTLIEHLPKRQMIKEKLATPHGVELIKRLGEQYSGESIDYTDGLKINRPDSWVLIRAS
GTEPLVRIMVDADESATAIALLAEIKKSVLENLEVLSHTH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagaaaaaatacagaaacagttgttcgggacaaatggcgtgcgggggatagca
ggaacagaaattactccggatctagcacttgccatcggaaaggtactcggaacaatgaga
ccaggcaggatcgctgtcggccgggacacgcgcactaccgggcctgcacttgccaatgca
ttaaaggccggccttcttgccaccggttgcagggtgatagattgtggtgtactccccaca
ccagcccttcaatatatcataaaagaacactatgacggaggagcaatgatcactgcctcc
cacaatcccccggaatataacggggtaaaaattatcgaacccgacggaaccgagatgggg
gatgaagaaactgtcaggcttgaacatctgctctcaaagaattcaacaccagttaaactc
tggagcgaagtcggaacagaaacagcagcaccaaacctgattgaagaatatgtagaagcg
gttgtcaggcatttcacgggaaaacccgggagtgggatgaccgtcatcgtggatcccgga
tccggtcctgcctgccagaccacccctgcaatcctacaagccctgggatgcagggttctt
accattaatggtgttatggacggaaccttccccgggcgcctgccggaaccatcaccggaa
ggtcttgcaaatctggctgcgctggtgaaggcaaacaatgctgcctttggtgttgcccac
gatggcgatgccgatcgagccgtttttgtagataacaaaggaaatttcgtcgaagaaaat
cacgaattcgcccttattgcacaatatatatgtaggaatgcaaagggtgccatcgttaca
ccggtcagtacatcgcagctggttgaacaggtagccaatgccgaaggatgcaccgttcag
tacacccctgtgggtagcatttacgttgcccgaaagatgcgggagctcattgattccggg
atttccgttgttttcggtggggaaggcaatggtggactaatctttcccgatcaccagttc
tgccgggacggggggatgactgcagcttccatggtttttcttctttccctatcgaatcag
aatctttccacactcattgaacatctgccaaaacggcagatgataaaggaaaagttggca
accccacatggggtagagcttatcaaaaggctcggggagcagtactcaggggaatctata
gattatactgacggtctcaagatcaataggcctgattcttgggtattgatccgggcttcg
ggcacagagccacttgtccgcatcatggttgatgccgatgaaagtgcaacagctattgcc
ctgcttgcagaaattaaaaaatctgtactggaaaatcttgaagtattatctcatactcat
taa

DBGET integrated database retrieval system