KEGG   Methanoregula boonei: Mboo_0762Help
Entry
Mboo_0762         CDS       T00578                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mbn  Methanoregula boonei
Brite
KEGG Orthology (KO) [BR:mbn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Mboo_0762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ABS55280
UniProt: A7I6B9
Position
complement(731268..732299)
Genome map
AA seq 343 aa AA seqDB search
MIPAPLILIVAIIIIALVFDFTNGFHDSANSISTVVSTKVLSPRNAVIFAAFFNFLAAFG
FGVAVADTIANIVQLNVVAAGIIPYIVLAALTGAISWNLITWFFGLPTSSSHALIGGLAG
AGISAAGLVAIKWATVGQVALFMVLSPLIGLTCGFLFMAAILWITRKASKPTAEGHFKRL
QLCSAAAYSFSHGTNDAQKTMGIIVPLLFSLGYYGANANSSHLSVPFWVIIICYTTIALG
TLAGGWRIVRTMGYKITKLRPVHGFAAETAGAATILGASAAGIPVSTTHVICSSIMGVGT
TMGASTVKWGVARSIMIAWILTIPISALIGYGAFQAIRLVVGS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgatccctgccccgctcatccttattgttgcgattatcatcatcgcactcgtctttgat
ttcaccaacgggttccatgactcggcaaattcaatatcaacggtggtctccacaaaagtc
ctctcgccccggaacgccgtgatctttgctgcttttttcaactttcttgcagcattcggc
tttggtgtggcagtggcagatacaattgcaaacatcgtccagcttaatgtggttgcggcc
ggaattatcccctatatcgtccttgctgccctaaccggggcgatcagctggaacctgatc
acctggttctttggcctgcccacctcctcatcccatgcgctgatcggcggtcttgccggc
gccggtatctccgcggccgggcttgtagccatcaagtgggcaacggtaggccaggtggcc
ctttttatggtcctctccccgctgatcgggcttacctgcggctttttgtttatggccgcg
atcctctggatcacaaggaaagcaagcaaaccgacagcagaaggccatttcaaaagactc
cagctctgctctgcggcagcctatagtttcagccacgggacaaacgatgcccagaagaca
atggggatcattgtcccgctcctcttttccctgggatattatggtgcaaatgccaattcc
agccatctgtcggtgccgttctgggtgattattatctgttataccacaatcgctctcggg
accctcgccggcggatggcggatcgtgcggaccatgggatacaagatcaccaagctccgc
ccggtgcacggttttgcggcagagaccgccggggcggcaaccatccttggcgcatcggca
gcaggcatcccggtgagtacgacgcatgttatctgctcgtccatcatgggggtaggtacg
accatgggcgcaagtacagtaaagtggggcgttgcacgcagcataatgatagcctggatc
ctgactatccccataagcgcactgatcgggtacggcgcattccaggcgatccggctcgtg
gtcgggagttaa

DBGET integrated database retrieval system