KEGG   Methanoregula boonei: Mboo_1283Help
Entry
Mboo_1283         CDS       T00578                                 

Definition
(GenBank) Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mbn  Methanoregula boonei
Pathway
mbn00010  Glycolysis / Gluconeogenesis
mbn01100  Metabolic pathways
mbn01110  Biosynthesis of secondary metabolites
mbn01120  Microbial metabolism in diverse environments
mbn01130  Biosynthesis of antibiotics
mbn01200  Carbon metabolism
mbn01230  Biosynthesis of amino acids
Module
mbn_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mboo_1283
Enzymes [BR:mbn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Mboo_1283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N
Motif
Other DBs
NCBI-ProteinID: ABS55801
UniProt: A7I7U0
Position
complement(1303991..1304962)
Genome map
AA seq 323 aa AA seqDB search
MLRHYAENPPGNIRLTTANSSTSLEDLAYLIKYDSVHGKAPFPVSYGEDYLTLGSHRLDV
VNNRDPARIPWKEHGIDIVLECTGVFTKRIAAAAHITAGASRVIISAPSADADATFVIGV
NERSFDPKKHHIVSNASCTTNSLAPVAKVLNDAFGIESLMMTTVHAYTASQALVDDSART
KRRGRAAAVSLVPSTTGAAEATALTIPALKGKMHAMAIRAPVPDGAITDIVVHVGRHVTV
QEVNDILKMAAENELAGIMEYCEDELVSADIIGNPHSAIIDASSTAVVNGNVVKVMAWYD
NEWGYARRLLDLASYIAGRMEAG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgctcaggcattatgcagaaaacccgccgggtaatatccggcttactaccgctaattcc
tcgacatccctggaggatcttgcgtacctgatcaaatacgattcagttcatggcaaagcc
ccatttccggtgtcgtatggcgaggattacctcacgctcggatcccaccggcttgacgtc
gtgaataaccgtgatccggcccggatcccatggaaggaacacggtatcgatatagtgctc
gaatgcaccggtgtgttcacgaagcggatagcggctgctgcacatatcacagcaggtgct
tccagggttatcatcagcgccccgtcagcggatgctgatgcgaccttcgtaatcggtgtc
aacgagaggtccttcgatccgaaaaaacaccacatagtctcgaatgcatcttgtacgaca
aacagtctcgctcccgtggctaaagtgctcaatgatgcgttcggtatcgaatccctgatg
atgacaaccgttcacgcatataccgcgagtcaggcgctggttgacgactcggcacgaacc
aaacggcggggacgggctgcggcagtatcactggtcccttcgacaaccggtgccgcagag
gcgacggcattgaccatcccggcactgaagggtaaaatgcacgcgatggcaatccgtgct
cccgtcccggatggggcgatcaccgatatcgtagtgcatgtcggacggcacgtcaccgtt
caggaggtcaatgatatcctgaagatggcagccgaaaacgagttggccggcatcatggag
tattgcgaggatgagctggtgtcggccgatatcatcgggaatccgcattccgcaatcatc
gatgcctcatcgaccgctgttgtcaacgggaatgtggtcaaagtgatggcctggtacgac
aacgagtggggctatgcgaggcgactgttggatctcgcgtcatatattgcaggtcgcatg
gaggccggatga

DBGET integrated database retrieval system