KEGG   Methanoregula boonei: Mboo_1352Help
Entry
Mboo_1352         CDS       T00578                                 

Definition
(GenBank) NAD(+) kinase
  KO
K00858  NAD+ kinase [EC:2.7.1.23]
Organism
mbn  Methanoregula boonei
Pathway
mbn00760  Nicotinate and nicotinamide metabolism
mbn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Mboo_1352
Enzymes [BR:mbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.23  NAD+ kinase
     Mboo_1352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_kinase DAGK_cat CHASE4
Motif
Other DBs
NCBI-ProteinID: ABS55870
UniProt: A7I809
Position
1377787..1378599
Genome map
AA seq 270 aa AA seqDB search
MKCFLVSRIDMPGALDCASRMKTALERAGHTVVLDPDTASMLGGSGHSINKVSADMAVVI
GGDGTILRTVQQLHEQIPIIGINHGEVGFLADLEPEEAGAFVRSLAPGFDVEERMRLSLW
NEEDHLGDALNEGLIVTTRPAKMLRFSILVDGRLTEQFRSDGILVSTPTGSTAYAMSAGG
PIVDPRIEGFLLVPLAPYLLSSRPHLISSSRRLEIRLESSKPAKLVIDGQNTVELGSAVS
LVIQKAASPARFIDVHRNFFEKVDRKLRKL
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgctttcttgtttcccgtattgacatgcccggagcccttgactgcgccagccgg
atgaaaacggcgctggaacgtgcaggacatactgtggttcttgacccggatacggcatca
atgctgggaggttccgggcattccataaacaaggtttccgcagatatggccgtcgtgatt
gggggagacggcacgatcctgcgcaccgtgcagcagctgcacgaacagatccccatcatc
gggatcaaccatggcgaggtggggttccttgcagacctcgagcccgaagaggcgggagcg
ttcgtgcgatcccttgcgccgggctttgacgttgaggagcgcatgcggctctccctgtgg
aacgaagaggatcacctgggcgatgccctgaatgaggggcttattgtcaccacccggccg
gcaaagatgctccggttctcgattcttgttgacggaagactcaccgagcagttccgctca
gacgggattctggtgagtacacccaccggatcgaccgcatatgcgatgagcgccgggggg
ccgatcgtggacccccggatcgagggattcctccttgtcccgctcgccccgtacctgctc
tcgtcccgtccccaccttatttccagcagccgcaggctggagatccggctggagagttca
aaaccggcaaaactggttattgacggccagaataccgtggaactggggagcgcggtctcc
cttgtaatacagaaggcagccagcccggcacggtttatcgatgtgcaccggaatttcttt
gagaaggtggaccgcaaactccggaaactctag

DBGET integrated database retrieval system