KEGG   Methanoregula boonei: Mboo_1526Help
Entry
Mboo_1526         CDS       T00578                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
mbn  Methanoregula boonei
Pathway
mbn00500  Starch and sucrose metabolism
mbn01100  Metabolic pathways
mbn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mboo_1526
Enzymes [BR:mbn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Mboo_1526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: ABS56044
UniProt: A7I8I3
Position
1593494..1595653
Genome map
AA seq 719 aa AA seqDB search
MADHKDGLADRFPHVPERLSGLVDLAYNLWWSWHPEARVLFKQINQQAWKKSLHNPVKML
RDIPPEYLDGVLANPAYLRRYDIIMNRFSRYMANHSGWFSEHYPKEKSQPIAYFSAEYGL
HHSLPFYAGGLGFLAGDHLKECSDLGVPLVAVGFMYSEGYLHQHIRPDGWQDNITEVLDR
DAAPITRVLNAAGNQMVIQVPFIEPRMYAAAWKVNVGKIPLFLLDTDIAENLPENRTISH
RLYAEQTAQRLKQEIVLGIGGRKMLAELGIGFAAVHLNEGHPAFALLEGIRERVAAGMTF
PDAMEQVKRTSVFTTHTPVPAGNDIFPRDLMNTYFSSYYGQMGIDAETFFGLGHHPCDEG
TGFNMTAFALRLTQYHNAVSKKHGTVARAMWHCMWPGTSEQEVPIDHITNGVHLPTWLNP
RMETLYSDYFRCVDPLWHEDHDNPEIWQMIEEIPDKKLWEMHLWLKQKLFNRIRERKRIK
WGSQLNEPGNLVAEGLMLNPSVLTIGFARRFSSYKRADLIFHDRTRLKRILTNPWRPVQI
IFAGKAHPADNEGKEILQRIYEFAQQPEFGGRIGFVEDYGEQMAQYLVHGVDVWMNNPVP
PMEACGTSGMKASLNGVLNLSILDGWWIEGYQGKNGWAFEGDPSQETRDASDSTALYNLL
EKEVMPLYYSASMDGIPHGWVKMMKESIKSTSAAFSARRMVKEYVTRYYPTLVAGAQDR
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcataaggacgggcttgcagacaggttcccacatgtgccggaacggttatcc
ggccttgtcgatctggcatacaatctctggtggagctggcaccccgaggcacgggtgctc
tttaagcagatcaaccagcaggcatggaaaaaaagcctccataacccggtgaagatgctc
cgggatatccctcccgaatatcttgacggcgttcttgccaatcccgcatatcttcgccgt
tatgatatcatcatgaaccgtttttcccggtacatggcaaaccacagcgggtggttttca
gaacattacccaaaagaaaaatcgcagcccattgcctatttctctgcggagtacggcctc
catcactcgctcccgttttatgcaggcggcctcgggttccttgcaggggatcatttaaag
gaatgcagcgatctcggggtcccgctggtcgcagtgggattcatgtactccgaaggttac
ctccaccagcatatccgtcccgatggctggcaggataatatcacggaagtgcttgaccgc
gatgctgcgccgattacccgggtcctgaacgctgccggcaaccagatggtcattcaggtc
ccgttcatcgagccccggatgtatgcagcggcatggaaggtcaacgtgggaaaaattccc
ctcttcctgctcgatacggatattgcagaaaatcttcccgaaaacaggaccatctcccac
cgcctgtacgcagagcagaccgcacagcgcctcaaacaggagatcgttcttgggattggc
ggccggaagatgcttgccgaacttggcataggatttgccgccgtgcaccttaacgaaggt
catccggcatttgcgctgctggaaggaatccgggagcgcgtggcggcaggcatgaccttt
cccgatgccatggagcaggtgaaaagaacctcggtctttaccactcacaccccggtcccc
gccggcaatgatatctttccccgcgatcttatgaatacgtatttctcctcctattatggg
cagatgggtatcgacgctgagaccttttttggcctcgggcaccacccctgtgatgagggg
accgggtttaacatgaccgcgtttgccctcaggctcacgcagtaccacaacgcggtctca
aaaaaacatggtacggttgcccgggcaatgtggcactgcatgtggcccggcacaagcgag
caggaagtccccatcgaccatatcacaaacggggtccatcttcccacgtggctcaacccc
cggatggaaaccctgtactcggattatttcaggtgcgttgatcccctctggcacgaggac
cacgataacccggagatctggcagatgattgaggagatcccggacaagaaactctgggag
atgcacctctggctcaaacagaaactcttcaacaggatccgggagcgcaaaaggataaaa
tggggaagccagctcaatgagcccggcaaccttgtggcagaaggcctgatgctcaacccc
tccgtcctcaccatcggatttgcccgtcgtttttcttcctataaacgggcagatttgatt
tttcatgacaggacacgcctcaagaggatcctgaccaatccctggcgcccggtgcagatt
atttttgccggaaaagctcaccctgcagataacgagggtaaagagatcctccagcggata
tacgaatttgcccagcagccggaatttggcggcaggatcgggtttgtggaagattacggg
gaacagatggcccagtaccttgtccacggcgtggatgtctggatgaacaaccctgtaccc
cccatggaggcgtgcgggacaagcggaatgaaggcttccttaaacggggtactgaacctg
agcatccttgacgggtggtggattgagggctaccagggaaaaaacggatgggcgttcgaa
ggcgatccgtctcaggaaacgcgggacgcatcggactccactgcgctctataatctgctt
gaaaaagaggtaatgccgctttattattctgcatccatggacgggatcccccatggctgg
gtaaagatgatgaaggaatccataaagagcaccagtgcagcattttccgcccgccgtatg
gtcaaggaatatgttaccaggtactatcccaccctcgtggcgggtgcacaggacagatga

DBGET integrated database retrieval system