KEGG   Methanoregula boonei: Mboo_1527Help
Entry
Mboo_1527         CDS       T00578                                 

Definition
(GenBank) signal transduction histidine kinase
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAS_4 PAS HisKA_2 PAS_9 PAS_3 GAF_2 PAS_8 HATPase_c HATPase_c_2 PAS_7 GAF GAF_3 HWE_HK HATPase_c_3 DUF3552
Motif
Other DBs
NCBI-ProteinID: ABS56045
UniProt: A7I8I4
Position
1596336..1600019
Genome map
AA seq 1227 aa AA seqDB search
MMTVPAPLTTADGIPGMKDADFLRKTTCAFAILAIAICIAGILGNISGSLILSSVCRGCK
TLALSAALIWIFFGALLLLLSARQAGRTVRILVQAILVFIFGLECIEIAFSLNGAQFIVE
SWSVQAGSELFGSLSTPISPIASGLIAIAAAGLFFCTDPSLLSPSRLRAREITVISGGIL
TLMGFALALSYLFGTPLILAKAIIPIAAASALAAFFIGLGLIAAAGPFTVPVCYFMGNSI
RARLLRTFVSLSVAITLCETILFYVISAWLGISNEIMISASLVLFIVVTSVIVGRVSEMI
GQTLDKKEQELADKNAYLGELNDNLVSAEEKLRQTIETLIKNERDLHESEQFLRETEKIA
KIGGWKANPKTDYLQVSEGVYDIFGIPGHHRPGFSEGLNCFSREDQILIRESIETCLATG
KPFTHEIRITTGTNEEVWTEIRGLALVREGHLSSVIGTIQDISRRRKVEEMLKRESGKLD
ILAESARLLLGSEKPGHVVQRIGERVMQFLSCQVFFNYLIDETGQRMELNAYAGIAQEDA
EQIRYLNLGDAVCGRVARDSKRMVIYDILSTDDEKTRLVRSLGISGYACHPLIFQGRTLG
TISFGTADRACFSEDELDLMQSVTALVATAMAQKQIADTLKSTSQYLESLINYANAPIIV
WDPDYRILRFNHAFEFLTGFSADEIIGKPLDILFPEKSRRDSMELIRRTSGGERWESVEI
PVMHVSGSVKMVLWNSANVYDPDGAAIVSTIAQGQDITERKNAEETARQTASLLRAALDS
TGDGILVVDNARTITGYNKKFCAIWGIPEPVLDDCAREAIALVSMARQVVDAKEFTGHLN
DLYNHPGRESYDTVKLKDGRIFERYSLPQKIGDTIVGRVWSYRDITERRQAEIALQESLE
KFRVIATSTPDHILVQDKNLRYTQVINPQPGLTGQDMIGKTDYEILSREEADTLTTIKKQ
VLETGSAVSSEMHLTNARGEKNYFSGAYVPTRNEAGEVDGLIGYFRNVTEKKQANEKILA
ALAEKEVLIREIHHRVKNNLQIVTGLLDMTRTRAQDPETTGILTDMMLKIKTMARIHTRL
YESNQSGQVSMDGQIRDMVTDLSGIYLPSSPGIRCEVDAEEFSLPVDLAIPCALVINEIL
SNSFKHAFRERTHGTIRVLAHRTGEQVHISIRDDGTGIPEQVDPERTASLGLKLIRNLVN
QLQGTLTIGSPEEGTEVTIDFPAKTGG
NT seq 3684 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccgtaccggccccccttaccactgctgacggcatacccgggatgaaggatgca
gactttttaagaaaaactacctgcgccttcgccattcttgccattgcgatctgcatcgca
ggcatcctcggaaatatatccggcagtctcatcctgagcagtgtatgcagagggtgcaag
acccttgcgctgagtgctgcactcatatggatcttttttggcgccctccttctcctgttg
tccgcacggcaggccgggcgtaccgtgcggatcctggtacaggcaatcctggtttttatt
ttcggcctggaatgcattgagattgcattcagcctgaacggagcgcagtttatcgttgaa
tcatggtcggttcaggcaggatcggagctttttggatcgctgtcaacgccgatatccccc
atagcctccggcctcatcgccatagctgcagccgggctgtttttctgcaccgatccttcc
ctcctgtcaccttcgcgcctcagggcacgggagatcacggtcataagcgggggcatcctc
acgcttatggggtttgcgctcgccttaagttacctgtttgggacaccgcttatccttgca
aaagcgatcatccccattgcagctgcctctgcccttgctgcgttttttatcggcctgggg
ctcattgccgctgcaggacctttcacggttcccgtctgttattttatgggaaattccatc
agggcgcggctgttgaggacctttgtctccttaagtgtagcaataacgctctgtgaaacc
atccttttttacgtcatttctgcatggcttggtatctccaatgagatcatgatctcggca
agccttgtcctctttatcgtcgttacctcggttatcgtcggccgggtatcggagatgatc
ggccagacccttgacaaaaaagagcaggaacttgcagacaaaaatgcatatctcggagaa
cttaatgacaacctggtatccgcagaagagaaactaaggcagacgatcgagaccctcatc
aaaaacgagcgggacctccacgaaagcgaacaattcctccgggaaaccgagaagattgca
aagatcggcgggtggaaggccaacccaaagaccgattatctccaggtgagcgaaggggtt
tatgacatcttcgggatcccggggcatcaccggccgggattctccgaaggcctgaactgt
ttttcccgggaggatcagatccttatccgcgaaagtattgaaacgtgccttgccaccggt
aagccgtttacccatgagatcaggatcaccaccgggacaaatgaggaggtctggacggag
atcagggggcttgctttggtcagggaggggcacctgtcctcggttatcgggaccatccag
gatatctcacggcgccggaaggttgaagaaatgctcaaacgggagagcgggaaactggac
atacttgcagaatccgcccggctcctccttggttccgaaaaacccgggcacgttgtccag
cgcataggggaacgggtaatgcagttcctttcctgccaggtctttttcaattatcttatc
gatgaaaccggccagcggatggaactcaacgcttatgccggtattgcacaggaggacgca
gagcagatccggtaccttaacctgggagatgcagtctgtggcagggtggcccgcgacagc
aagcggatggtaatttatgatattctcagcaccgatgacgaaaaaacacgcctggtccgg
tccctgggcatttccgggtatgcatgccacccgcttatcttccagggccgcacccttggg
acgatctcctttggcaccgctgaccgggcctgttttagcgaggatgaactggacctgatg
cagtcagtgacggcccttgtggctactgcgatggcgcaaaagcagatcgcagatactctc
aaaagcacaagccagtacctggagagcctgataaattacgccaatgcaccgatcattgtc
tgggacccggactaccggatcctgcggttcaaccacgcatttgagttcctgacgggattt
tctgcggacgagatcatcggaaagccgctcgatatcctgttcccggaaaaatcccgccgg
gattccatggaactcataaggaggaccagtggaggggaacgctgggaatcggtggagatc
ccggtcatgcatgtttccggctctgtaaaaatggtcctgtggaactctgcaaacgtatac
gatcccgacggtgcggccatagtctccaccatagcgcagggtcaggatatcacggagcgt
aagaacgcagaagagactgccagacaaactgcatcgttactcagggcagccctcgattcc
accggtgacggcatccttgtagtcgacaatgcacgaaccattaccggctataacaagaaa
ttctgtgccatctggggcatccccgaacctgtgctcgatgattgtgcccgcgaggcaatc
gcgcttgtttccatggcacggcaggtagtagatgcaaaagagtttaccggccacctcaac
gacctgtacaaccacccggggcgggagagttatgatacggtaaagctgaaggatggcagg
atcttcgagaggtactcgctgccccagaagatcggcgacaccattgtcggccgtgtgtgg
agctaccgtgacattaccgagcgcaggcaggctgagatcgccctgcaggaaagcctggag
aaattccgggtcattgcaacgagcacgccggaccatatcctggtgcaggacaaaaatctc
cggtatacccaggtcatcaatccccagccgggacttaccgggcaggatatgatcgggaaa
accgattacgagattctctcaagagaagaggcagacaccctgacaacgatcaagaagcag
gttcttgagaccggtagcgcagtcagcagtgaaatgcacctgacaaacgcacggggcgag
aaaaactacttttccggggcatatgttcctacaaggaatgaagcaggggaggttgacggc
cttatcgggtatttccggaacgtgaccgaaaagaaacaggccaatgaaaagatccttgca
gcgcttgcggaaaaagaggtcctgatccgggagatccaccaccgggtgaaaaacaacctc
cagatcgttaccggcctccttgatatgacaaggacacgggcccaggaccctgagaccacc
ggtatcctcacggacatgatgctgaagatcaagactatggcccgtatccacacccgtttg
tacgagagcaaccagtccggccaggtcagcatggacggccagatccgggatatggtaacc
gatctctccggcatctacctgccttcctctcccggcatcaggtgcgaggtggatgcagaa
gagttctccctcccggtcgatcttgcaatcccctgtgcgctggtcattaacgagatcctt
tccaactcgttcaaacatgccttcagggagcgcacccacgggacgatacgggtactggca
caccggacgggcgaacaggtccatatcagtatccgggatgacgggacaggcatcccggaa
caggtggatccggagcgtacggcaagccttggcctcaagctgatacgcaacctggtaaat
cagttacagggaacgcttactattggaagccccgaagagggtacagaagtcacgatcgat
tttcccgcaaaaacgggaggataa

DBGET integrated database retrieval system