KEGG   Methanoregula boonei: Mboo_1531Help
Entry
Mboo_1531         CDS       T00578                                 

Definition
(GenBank) peptide methionine sulfoxide reductase
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMSR Glutaredoxin SH3BGR DUF836
Motif
Other DBs
NCBI-ProteinID: ABS56048
UniProt: A7I8I7
Position
1604299..1605081
Genome map
AA seq 260 aa AA seqDB search
MDEKQGTGKNVKKATFAGGCFWCMQPPFRALNGVIDAVSGYAGGKKENPTYEEVSGGTTG
HLESVQVTYDEDRIPYDTLLDTFWKQIDPTDPAGQFADKGSQYKTAIFYHDDEQKRQAEE
SKKKVEASGKFAHPVATEIRPYTNFYPAEEYHQDYDKKNPGRYQQYKALSGRESFIRKLW
GKPRVVRVYATPGCSGCRAVKEYLKSKNVEFTEIDIAADERARTLVMEKTGHLGSPYVQI
DDTFIFGFDRKKLDQLLQGT
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaaaacagggaacgggaaaaaacgtaaaaaaagcgacctttgccggcggatgc
ttctggtgcatgcagccgccgttccgggcgctcaacggtgtgatcgatgcggtatcggga
tacgcaggcggaaaaaaggagaacccgacctacgaggaggtttcgggcgggacgaccggg
cacctcgaatcggtgcaggtgacctatgacgaggataggatcccgtatgatactctcctt
gacacgttctggaagcagatagacccgaccgatccggcagggcagttcgcggacaagggg
tcgcagtacaaaaccgccatattctaccacgacgacgaacaaaaacggcaggcagaagaa
tcgaaaaagaaggtcgaggcttcaggaaagtttgcacaccctgttgcaacagagatccgg
ccgtacacgaatttctacccggccgaggaataccaccaggactatgataagaaaaatccc
gggagataccagcagtacaaggcgttgtccggccgcgaatcattcatcaggaaactctgg
ggtaaaccccgcgttgtccgggtctacgcgacaccgggatgttccggctgccgtgcggtt
aaggaatacttaaaatcgaagaatgtggaattcaccgagatcgatatcgccgcagatgag
agggcaaggacgcttgtcatggaaaaaaccggccacctcggttcgccctatgtccagatc
gatgataccttcatcttcgggtttgaccggaaaaaactggaccagctcctgcagggaact
taa

DBGET integrated database retrieval system