KEGG   Methanoregula boonei: Mboo_1539Help
Entry
Mboo_1539         CDS       T00578                                 

Definition
(GenBank) NADH:flavin oxidoreductase/NADH oxidase
  KO
K10680  N-ethylmaleimide reductase [EC:1.-.-.-]
Organism
mbn  Methanoregula boonei
Pathway
mbn00633  Nitrotoluene degradation
mbn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mbn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mboo_1539
Enzymes [BR:mbn01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     Mboo_1539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_FMN ICL AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ABS56056
UniProt: A7I8J5
Position
1610907..1611983
Genome map
AA seq 358 aa AA seqDB search
MSLFSPYVLGDLVLANRMIMAPMTRCRAIDCNVPGPLSVIYYVQRAAAGLIITEGSQVSP
QGVGFIRTPGIYSDEQVAGWKKVTSAVHQAGGKMFIQLWHVGRVSHPDFLDGGLPVAPSA
LPVNEVIHTPLGKMMIPIPRALGLTEIPKIVHEFQDAAAYAKEAGFDGVEIHGANGYLLD
QFLRDGSNHRTDRYGGSLANRARLPIEITEAVVAVWGAKKVGYRISPHFNLHAMSDTHPR
ETFGHLADRLSKLGIAYIHLVEPVGGKLGEVSPDAQMAPLIRKKFDGALILNGGYDKESA
TRVIEDGLADLVAFGTLFLANPDLPERFKRGAPLNTEDPATFYTGEEKGYTDYPALGK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagtttattctccccgtacgttttaggtgacctcgtgcttgcaaaccggatgataatg
gcgccgatgacccggtgccgcgccatcgactgcaatgtcccgggtccgctctcggtcata
tactatgtccagcgggcagcggccggtctcatcatcactgaaggttcccaggtcagcccg
cagggcgtggggtttatccggacgcccgggatttattcggatgagcaggttgccggctgg
aagaaggtaacttctgccgtccaccaggccgggggaaagatgtttatccagctctggcac
gtgggccgcgtgtcgcacccggattttctcgacggtggcctcccggttgcgccctctgcc
ctcccggtcaacgaggtgattcacacgcccttgggaaagatgatgatccccatcccacgg
gcgctcgggcttacggagatcccaaagatcgtgcatgagttccaggacgccgcagcctat
gccaaagaggcggggtttgacggcgtcgagatccatggggcaaacgggtacctgctggac
cagttcctgcgggacggttcaaaccatcgtaccgaccggtacgggggaagccttgcaaac
cgggcacgtcttcccatagagataacagaagcggtagttgcggtctggggtgcaaaaaag
gtaggctaccggatctcgccgcacttcaacctccatgcaatgtcggacacgcacccccgg
gaaactttcgggcacctggcagaccggctcagtaaactcggcatcgcgtacattcacctt
gttgaaccggtcggcggcaaactgggggaggtaagcccggatgcgcagatggccccgctc
atccgcaagaaattcgacggggccctgatcctgaacggggggtacgacaaagagagcgca
acccgggtaattgaagacggccttgcagaccttgtggcatttggcaccctgttccttgca
aacccggatcttcccgagcgtttcaagagaggtgcaccgctgaacacggaagacccggca
acgttctataccggtgaggaaaaggggtacacggattaccctgcactgggaaagtaa

DBGET integrated database retrieval system