KEGG   Methanoregula boonei: Mboo_1540Help
Entry
Mboo_1540         CDS       T00578                                 

Definition
(GenBank) Phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
mbn  Methanoregula boonei
Pathway
mbn00010  Glycolysis / Gluconeogenesis
mbn01100  Metabolic pathways
mbn01110  Biosynthesis of secondary metabolites
mbn01120  Microbial metabolism in diverse environments
mbn01130  Biosynthesis of antibiotics
mbn01200  Carbon metabolism
mbn01230  Biosynthesis of amino acids
Module
mbn_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mboo_1540
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mbn04147]
    Mboo_1540
Enzymes [BR:mbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     Mboo_1540
Exosome [BR:mbn04147]
 Exosomal proteins
  Proteins found in most exosomes
   Mboo_1540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK
Motif
Other DBs
NCBI-ProteinID: ABS56057
UniProt: A7I8J6
Position
1612181..1613368
Genome map
AA seq 395 aa AA seqDB search
MQKKTVEDEEVYGKRVLVRADFNVPMDRNGTIEDDTRIRACLPTITYLIDHRARIILCSH
LGRPQGRVDGHLRLEPVARRLSELLQRPVKPLREAIGPEVERAVSGMENGEIILLENLRF
YPGDEENDPGFARELASLADLFVNDAFGASHRAHASVVGLAAYLPCVAGLLMEKEIERLG
SLLENPRRPFAAIMGGAKVEEKIGILENIISKVDLILIGGGMSATFLKGQGWDAGISPVE
PDKMEIVRAIMQKAGALGVRILLPQDVIVTEKLKTGAIARGVSAQQIPADSIIADIGPQT
ITEFTKELKNCRTVVWNGPMGVFEIPQFSEGTKSIATALADLHAMTIVGGGSTAEAVTKL
GLSGKMTHVSTGGGATLLFLSGKILPGIAVLADKE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaaaagacggtggaggatgaagaggtatatgggaaacgggtgctcgtgagggct
gatttcaatgtgcccatggaccggaacggtacgatcgaagacgacacccggatccgggcc
tgtcttcccacgatcacctatctgatcgatcaccgggcccggatcatcctctgctcccat
ctcggcaggccgcagggcagggtagatgggcacctgagactggagccggtagcgcggcga
ctgtcagaactcttgcaaaggccggtcaagccgctcagggaggcgatcggacccgaagtt
gagcgggctgtatccggcatggaaaacggcgagatcatcctcctggaaaacctgaggttc
tacccgggcgatgaagagaacgatcccggttttgcccgtgaacttgccagtctggcggat
ctctttgttaacgatgcctttggcgcaagccaccgggcacacgcatcggttgtaggactg
gcagcgtatcttccctgcgtagccggtctcctaatggaaaaggagatcgagagactcggc
agtcttcttgagaaccccaggaggccttttgcagccatcatgggcggggcaaaagtggag
gagaagatcggaattctggaaaatatcatttccaaagtggatctcatccttatcgggggc
gggatgagtgccacgtttttaaagggccagggctgggatgcgggaatctctcctgtggaa
ccggacaagatggaaatagtcagggcgattatgcagaaagcaggagcccttggtgtaagg
atcctgcttccacaggatgtaattgtcacggaaaaactaaaaaccggtgccattgcccgg
ggggtgagcgcacagcagatccccgccgatagcataatagcggatatcgggccccagacc
attacggagtttacaaaagagctcaaaaactgccggactgtggtatggaacgggccgatg
ggggtctttgagatcccgcagttttccgaagggacaaaatccattgccacggctcttgca
gatctccatgctatgacgatagtcgggggtggttcaacggccgaggccgtgacaaagctc
gggctttccggcaaaatgacccatgtctcaaccggcggaggagcaaccctcctgttcctc
tcgggaaagatactgcccgggatagcggtcctggcggacaaggagtga

DBGET integrated database retrieval system