KEGG   Methanoregula boonei: Mboo_1546Help
Entry
Mboo_1546         CDS       T00578                                 

Definition
(GenBank) hypothetical protein
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Endomucin
Motif
Other DBs
NCBI-ProteinID: ABS56063
UniProt: A7I8K2
Position
1617044..1617568
Genome map
AA seq 174 aa AA seqDB search
MKLLMGFIVLLVALVAVTGCTQTASPSVQTTTATTAPATTAVTTVTTAVPTTIATTVPVN
TTAEETLSWEATPTPASMVTIIHLTSAGFTPETDIVLPGTSVFFANNDNVTHTIVGIGNS
TGTFNSGEIIPGSAFPYTFGIKSGILYYGLADNASVMGTIIVQPPSGTTTYHSA
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgctcatgggatttatcgtccttcttgtcgcactggtggcggtcaccggttgc
acccagaccgcatcgccttcagtacagaccacaaccgcaacaactgctccggcaactact
gcggtcacaacggtgacaactgccgttcccacaacgattgcaaccacagtaccggtaaac
actactgctgaggaaaccctgtcctgggaggccacacccaccccggcatccatggtcacg
atcatccatctgacgagcgccgggttcactcctgaaaccgatatcgtcctgccgggcacc
agtgtcttctttgcgaacaatgacaatgtcacccacacgatcgtaggcatcggtaacagc
accggcacgttcaactcaggtgagattatcccgggttcagcattcccgtacacatttggt
ataaaatcggggatcctttactatggtctggcagacaatgcctcagtgatggggaccatt
atcgtccagccgccttccggtacaacaacgtatcactcagcgtag

DBGET integrated database retrieval system