KEGG   Methanoregula boonei: Mboo_1548Help
Entry
Mboo_1548         CDS       T00578                                 

Definition
(GenBank) hypothetical protein
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABS56065
UniProt: A7I8K4
Position
complement(1618618..1618929)
Genome map
AA seq 103 aa AA seqDB search
MNNLQFFPMPRGRPKGSKNLSVYEQGKVRKIRENLAKNGIGDFDKLRDAQVLHNIHVSTD
GEVFVKYEISRHPRIKNSEKKENKGEKLIGRIEKDLAALRETL
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgaataatctacaattttttcccatgccacgaggacgacccaaaggatcaaaaaacctg
agcgtgtacgaacagggaaaagtcagaaaaatccgtgagaaccttgcaaagaacgggatt
ggggattttgataaactccgggatgcacaggtccttcataatatccatgtcagcacggat
ggagaggtttttgtaaagtacgaaatctcccgacacccccggataaaaaattccgaaaag
aaagagaacaaaggcgagaaacttatcggcaggatagaaaaagacctcgcagccctccgg
gaaaccctgtag

DBGET integrated database retrieval system