KEGG   Methanoregula boonei: Mboo_1551Help
Entry
Mboo_1551         CDS       T00578                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3821
Motif
Other DBs
NCBI-ProteinID: ABS56068
UniProt: A7I8K7
Position
1620853..1621764
Genome map
AA seq 303 aa AA seqDB search
MTRQSMFALCTLGLLVLVAAVPVSATCYAINNTITVPGATVFIGEQQLNLNNLTASDPLL
KSDDAIGWWASAASPATSAPARSYRLSNLDLGSFYVSPAAFGNWPGNWYGMKNGMWDGGP
ALFSVQDPRVSLDIWDLSTATTVTGGTVHRGDYLAFRISTNMQSALDPAKRGQSATGAEA
GNFDLQVKGPTGITYTELLSGTGSDATSLTSQNANLPLWFWGTKDAKVPSSSNAAANWST
GAVDQTGQNAYPSGVYTVTARSRLNGMYDNYQNGGATYTGKTVSQPATVSISVPRNPVIP
ETS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaccagacaatctatgtttgcactctgtacgctgggtctgttggttcttgtcgcagca
gtgcccgtatcggcaacctgctatgctatcaacaacacgattaccgtcccgggtgcgaca
gtgtttattggagaacagcaactgaacctgaacaacttaaccgcatctgacccgctcctg
aagtcagacgacgcgatcggctggtgggcgtccgcagcatcgcctgctacctctgcacct
gcgcgatcctaccgtttgagtaaccttgacctgggatctttttatgtctctcctgctgcc
tttgggaattggccgggcaactggtatggtatgaagaatggaatgtgggacggcgggcct
gcactcttctcggtacaggatccccgtgtctctctcgacatctgggatctttccaccgca
accacagtaaccggcggtacggtgcacaggggagattaccttgcgttccgtatcagcacg
aacatgcagtctgcacttgacccggccaaacgcggccagagtgctaccggtgccgaggcg
ggtaacttcgatctccaggtaaagggtcccaccggcatcacgtacactgagctgctcagc
ggcacgggttccgatgctacgagccttacgtctcagaatgccaatctcccgttgtggttc
tggggaacaaaggacgcaaaggtcccgtcatcctccaacgcagcagccaactggtcgacc
ggtgcagtcgatcagaccggacaaaatgcctacccgtccggtgtgtacaccgttaccgcc
cgctcccggcttaacggcatgtatgataactatcaaaatggcggcgcaacatacaccggt
aagaccgtcagccagcccgcaacggtcagtatttccgtaccccgtaacccggtgattccg
gagacttcctga

DBGET integrated database retrieval system