KEGG   Methanoregula boonei: Mboo_1576Help
Entry
Mboo_1576         CDS       T00578                                 

Definition
(GenBank) hypothetical protein
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alph_Pro_TM DUF4625 DUF4832 Wzt_C
Motif
Other DBs
NCBI-ProteinID: ABS56093
UniProt: A7I8N2
Position
complement(1645290..1645637)
Genome map
AA seq 115 aa AA seqDB search
MTGRWYLLLGFLLLLLCAAGCTSLSIGTVSYANNNLSIGVTGPQSPQEIGVQVTVYGVSD
LSQHELFTTGTTTTLDGTGQTVTIPADLAPGTYKIYVYLIANGNREAAVIRDITV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggcgctggtacctgcttttgggttttctgctgcttcttttgtgcgctgccggc
tgcacctcgctttccattggcacggtatcgtacgcaaacaacaatctctccatcggggtt
accgggccgcaaagccctcaggagatcggtgtccaggttacggtgtatggggtaagcgat
ctttcgcagcacgaacttttcaccaccgggaccacgaccactcttgacgggacggggcag
acggtgacaatcccggcagatcttgcaccgggcacgtacaagatatatgtctatcttatt
gcaaacggcaaccgcgaggccgccgtgatccgggatatcacggtgtga

DBGET integrated database retrieval system