KEGG   Methanoregula boonei: Mboo_1577Help
Entry
Mboo_1577         CDS       T00578                                 

Definition
(GenBank) ATPases involved in chromosome partitioning-like protein
  KO
K03496  chromosome partitioning protein
Organism
mbn  Methanoregula boonei
Brite
KEGG Orthology (KO) [BR:mbn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mbn03036]
    Mboo_1577
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mbn04812]
    Mboo_1577
Chromosome and associated proteins [BR:mbn03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    Mboo_1577
Cytoskeleton proteins [BR:mbn04812]
 Prokaryotic cytoskeleton proteins
  MinD / ParA class of bacterial cytoskeletal proteins
   Mboo_1577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_31 CbiA Fer4_NifH ParA CBP_BcsQ MipZ
Motif
Other DBs
NCBI-ProteinID: ABS56094
UniProt: A7I8N3
Position
1645998..1646798
Genome map
AA seq 266 aa AA seqDB search
MLVVDCDPQANATAGLGIVPDPEKKNIYDVFMSRVEGFPQVPITDIICSSESGIDVAPAT
LDLVGAEPYLYGIASRAEVLKDALWPVKQRYDFILIDTPPSMGQFVINGLVAADHVIVTL
DSGSFALAGVSPLLTIFGDIRESMGKNLSVDMAIISRWGEGGDLEPAVQEEETKKDLAGW
LRSLFSPRHEPSEEEKRAEKERVKEHERLQGMLGEVEKKFADVHTVPYSPEVYEAQKRGL
PLSHFAPDSSAGKAYRAIADEVIPWT
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgctggtggttgactgcgacccccaggcaaatgccacggccggtctcggcatcgtccct
gacccggagaaaaagaacatctatgatgtcttcatgagccgggtggagggttttccccag
gtacccataacagatatcatctgttcttccgaatccggtatcgacgttgcaccggcaact
ctcgatcttgtcggtgcagaaccctacctgtacgggatcgcgtcacgggccgaggtgctt
aaagacgctctctggccggtaaaacagcgttatgattttatcctgattgacactcccccg
agcatggggcagtttgtgattaacgggcttgttgccgccgatcacgtaattgtcactctt
gattccggctcctttgcccttgccggcgtgagtcccctcctgactattttcggggacatc
cgggagagtatgggtaagaacctcagtgtggacatggcaattatttcccgctggggagag
ggtggggacctggaacccgcagtgcaggaagaggagacaaaaaaagatcttgcaggctgg
ctgcgctcgctcttttccccccgtcacgagcccagtgaggaggaaaaaagggcagaaaaa
gaacgtgtgaaagaacacgagcggttacagggaatgcttggcgaggtagaaaagaagttt
gccgatgtgcataccgtgccgtactctcccgaggtgtacgaggcccagaagcgcgggctg
ccgctttcacactttgctcccgacagcagtgccgggaaggcatacagggcaatcgcagat
gaagtgataccatggacatga

DBGET integrated database retrieval system