KEGG   Methanoregula boonei: Mboo_1579Help
Entry
Mboo_1579         CDS       T00578                                 

Definition
(GenBank) putative CheW protein
  KO
K03408  purine-binding chemotaxis protein CheW
Organism
mbn  Methanoregula boonei
Pathway
mbn02020  Two-component system
mbn02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mbn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mboo_1579
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Mboo_1579
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:mbn02035]
    Mboo_1579
Bacterial motility proteins [BR:mbn02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mboo_1579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheW
Motif
Other DBs
NCBI-ProteinID: ABS56096
UniProt: A7I8N5
Position
1648784..1649296
Genome map
AA seq 170 aa AA seqDB search
MAGTIDVVEFELGGERYALDINLAREIVEMIPITPIPRAPAFISGVINLRGEITNIMNLN
TLLALPEKEVRENQKIIVLVPDAANGNNVGIIVDDVASVRQVSQDNIEHIGSGISSEFSQ
FVKGIIKVTNEDTEKKEKDLIIWLDMERVIADLGSGSRNGPGAGTRHDAL
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggccggaacaattgacgtagtggagttcgaattaggcggggagcggtatgcgcttgac
atcaacctggcgcgcgagatcgtggagatgataccgatcacccctatcccccgggcgccg
gcctttatctcgggcgtgatcaaccttcggggtgagatcaccaatatcatgaacctcaat
acgctccttgcgctgccggaaaaggaagtgcgcgagaaccagaagatcattgttcttgtg
cccgatgcggcaaacgggaacaatgtcgggattattgtcgacgatgttgcaagtgtccgc
caggtatcacaagacaacatcgagcacatcggctccgggatatcttcggaattctcgcag
tttgtcaaggggattatcaaggtcacaaacgaggatactgaaaaaaaggaaaaagatctc
atcatctggcttgatatggaacgggtgattgcagacctgggcagcgggtcaaggaacggc
ccgggagccggtaccaggcatgatgccctgtga

DBGET integrated database retrieval system