KEGG   Methanoregula boonei: Mboo_1580Help
Entry
Mboo_1580         CDS       T00578                                 

Definition
(GenBank) methyl-accepting chemotaxis sensory transducer
  KO
K03406  methyl-accepting chemotaxis protein
Organism
mbn  Methanoregula boonei
Pathway
mbn02020  Two-component system
mbn02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mboo_1580
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mboo_1580
Bacterial motility proteins [BR:mbn02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Mboo_1580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal PAS_4 PAS_9 PAS PAS_8 DUF948 YopE_N Cortex-I_coil
Motif
Other DBs
NCBI-ProteinID: ABS56097
UniProt: A7I8N6
Position
1649333..1652236
Genome map
AA seq 967 aa AA seqDB search
MTEQRPGRKALFVGAQAPAAVRTTPDEIAQKVRDLNEELALALKGAHAKKAVPPLDPAHF
GSEYTTLVDAVNTAAAQMTAPAPGVPAPGEMLPEMLAEYGKKIDVLERRLEFMEKNNPVP
MLIATPALDITEANAAYVALTGIPEDKIVKTNLHDFTITDRSGEGAREAIEKKRRAVGEL
TVTFPSGVHTLEQYCIPVLDSSGAVTSLVILYDDLTTKKKKNEEIERLKARSETIVQQNP
MPIVLVDTGFIIKVVNDAFVALAGREKDQLLSRSLNDLAITQQAGDGLKKVLETGTRSEG
EVVIESQGKAHRLRQYGIPIPGAKGAIENILVVYNDITGEKQEAGEGLDTRNLSEALIRE
NPIPILITDRSFTIISANTAFEKLSGYTPDRITGMNLRGIKIREQKGEGAGIAIREKRRA
SGEVTVDLPSGTKILEQYVMPLLDAKNSIEHLLLVYYDVTAQRASQQDLAKKMEEVAALK
KRSDIIVMQNPMPIMLMDPSFKILMANEAYTNLTGLSKEKIHGMSAREFKILSQSGEGLK
KVLEKKARSYGEVTIEFPRGLRILEQYGIPMLDAQQNLSTILCVYVDVTARREQENKIRA
MMDEAKANAELLSASAAELQTGLARIAAGDLTYQLSIDEADPLVRLKKDYNSSVAAIRSV
IAELMQSIRKLDVTIQDTIKSTDEIAKATEQVAISSQKATDNSKEQLAGVEKISVTVSDI
SASIEEIASTSHDVMAHAGKAAEEGSHAASVGKTATDKMQAVEKISQQSVNEITALNEQM
RQITKIVNLITDIANQTNLLALNAAIEAARAGEHGRGFAVVAGEVKNLAGESKKASNQIE
TLIKAIQTKSEVTATSIQDSFVQIKGGIESVNMTVESLNKIIAEASVVSQGLAEITKATE
SQAQATSGLMAGIDTLRRSTENNQHRMEDMAALAQETSASTEEIASASAELSIMAERCSG
MMKEFHT
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaacgaccgggacgaaaggcattgtttgtcggggcccaggccccggcggca
gtacggacaaccccggatgaaatagcacagaaagtccgggatctcaatgaagagcttgca
ctggcactcaaaggtgcccatgcaaaaaaggcagtaccaccgcttgatccggcgcatttc
ggcagcgagtacacaacccttgtggatgccgtaaacaccgctgcggcacagatgactgca
cccgcaccgggcgtgccggcccccggggaaatgctcccggagatgcttgcagagtacggg
aagaagatcgatgtgctcgaacgccggctcgaattcatggagaagaacaacccggtgccc
atgctgattgcaacaccggcacttgatatcaccgaggccaatgccgcatacgtggccctg
accgggatcccggaagacaagatcgtaaaaaccaatctccacgattttaccatcacggac
cggtccggtgagggcgcacgcgaagccatagaaaagaaacggcgggccgtgggcgaactc
accgttaccttcccctcaggagtccacaccttggaacagtactgcatcccggtccttgac
agcagcggtgcggtcacttcgcttgtcattctctacgacgaccttaccacaaagaaaaag
aagaacgaggagatcgagcggcttaaggcgcgctcagagacgattgtccagcagaacccg
atgcctatcgtgctcgttgataccggttttatcattaaagtggtaaacgatgccttcgtg
gcgcttgccggcagggaaaaggaccagttgctctcccggtccctcaatgaccttgccatc
acacagcaggccggggacgggcttaaaaaagtccttgagaccgggacccgttctgaagga
gaggttgtcattgagtctcaggggaaggcacaccggctccgccagtatggcatccccatc
cccggggcaaagggcgccatcgagaacatccttgtggtatacaacgatatcaccggggaa
aaacaggaggcaggcgaaggtcttgatacccggaacctgtccgaggcgctcatccgggaa
aatcctatccctatccttataaccgaccgctcctttaccatcatctcggctaacaccgcc
tttgagaagctgagcgggtatactcctgaccggatcaccggcatgaacctgcgcgggata
aagatccgtgaacagaagggcgaaggtgccggcattgcaatcagggagaaacgccgcgca
tccggggaagttaccgtggatctcccgagcgggacaaagattctcgaacagtacgtgatg
ccgctcctggacgccaaaaacagtatcgagcacctccttctcgtatactacgatgttact
gcccagagggcaagccagcaggaccttgcaaagaagatggaggaagttgcggccttaaag
aagcgctccgatatcattgtcatgcagaaccccatgcccatcatgcttatggatccctcc
tttaagatcctcatggcaaacgaggcctacacaaatctcaccggcctctcaaaagaaaaa
atccatggcatgagcgcacgggagtttaagatactctcccagtccggggaggggctcaaa
aaagtgcttgaaaagaaggccaggagctatggcgaggttaccatcgagtttccaagaggc
ctgcgcattctcgaacagtacggcatccccatgctggatgcacagcagaacctctccacg
atcctctgtgtgtatgtggatgtgaccgcccggcgcgaacaggagaataagatccgggcc
atgatggacgaggccaaggcaaatgccgaactgctctccgcgagtgctgccgagctccag
accgggcttgcacggatcgctgccggagatctcacataccagctcagcatcgatgaggca
gacccgctggtgcggctcaagaaagattacaactcgtccgttgctgcaatacggtcggtc
attgccgaactgatgcagtcaatccggaaactggatgtgaccatccaggacaccatcaaa
agtactgacgagattgcaaaagctaccgagcaggtggccatatcctcccagaaggcaacc
gacaattccaaggagcagctcgccggcgtggagaagatctccgtcaccgtctcggacatc
tctgcttccatcgaggagatcgcaagcacttcccacgatgttatggctcatgccggaaaa
gcggcggaggagggatcccatgccgcaagcgtgggcaagactgcaacagacaagatgcag
gcagtagagaagatctcgcagcagagtgtcaatgagatcacggcgttgaacgagcagatg
cgccagatcacaaagatcgtcaacctgattaccgatattgcaaaccagacaaacctgctt
gccctaaacgctgcgatcgaggccgcaagagccggcgagcacggtcgcgggtttgccgtt
gttgccggggaagtaaagaaccttgccggggagtccaagaaggcaagcaaccagatcgag
accctcattaaggccatccagacaaaaagcgaagttacggcgacatccatccaggactcc
tttgtgcagattaagggcggcatcgagagcgtgaacatgacggtcgaatcgctcaataag
atcatagccgaggcaagcgtggtctcccagggacttgccgagatcaccaaagccaccgag
agccaggcgcaggccacttccggcctgatggcagggattgacacgctcaggagatcgacc
gaaaacaaccagcaccggatggaggatatggcggcccttgcacaggaaaccagtgcctcc
acagaagagatcgccagtgcttctgccgaactctcgatcatggcagagcgctgctccggg
atgatgaaggagttccatacctga

DBGET integrated database retrieval system