KEGG   Methanoregula boonei: Mboo_1589Help
Entry
Mboo_1589         CDS       T00578                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABS56106
UniProt: A7I8P5
Position
complement(1659151..1659714)
Genome map
AA seq 187 aa AA seqDB search
MRDRYENIPADLTRLDRWVVWRYEERNGKLTKPPYVPAPGKMRHALVNVPSTWGTFEQAK
NTVNAGGFDGIGFVLGEGIFGIDFDHATDAMVQEALSLGSYTEWSPSGHGVHVIGRSAIV
LKGRKKGSVELYMQGRYFTVTGSVVPGSPPDIRVISPDRLLDFFRRHFEDEPVPGRNNGT
GSDTPEA
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatcggtatgagaatatcccggcagatcttacccggcttgaccgctgggtcgtc
tggcggtacgaagaacggaacgggaagcttaccaaaccgccgtatgtcccggcaccggga
aaaatgcgccatgcacttgtcaatgtcccctccacatgggggacttttgagcaggcaaaa
aacaccgtaaacgccggtggctttgacgggatcggctttgtcctgggagagggaattttc
ggcatcgatttcgatcatgcgactgatgcgatggttcaggaagcattatcccttggttcc
tatacggaatggagcccttccggtcacggggtgcatgtcattggccgttcagcgatagta
ctcaaaggcaggaaaaaaggatctgtcgaactctatatgcaggggaggtactttacggtt
accgggtctgtggtgcccgggtcgccaccggacatccgggtaatttcgcctgaccggttg
ctggactttttccggcggcattttgaggacgagccggtaccgggccggaacaatggcaca
ggctcggatacacctgaggcgtga

DBGET integrated database retrieval system