KEGG   Methanoregula boonei: Mboo_1598Help
Entry
Mboo_1598         CDS       T00578                                 

Definition
(GenBank) GtrA family protein
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GtrA
Motif
Other DBs
NCBI-ProteinID: ABS56115
UniProt: A7I8Q4
Position
1669975..1670442
Genome map
AA seq 155 aa AA seqDB search
MDVWEGDGPVASVARLLSREKIPGFVVIGIISTILDLGLLYGLTEYFHIWYLLSATVSYS
CGMVLNFLLNKFLNFQDTSRHYLWQFVTFALISSTGLALTLGVLYIAVEIFSQNYLVAKL
IAIILSFAWNYLGQSRITFSLGKHRISGDRRDYLR
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggatgtctgggagggggacgggccggtcgcatctgtcgcccggctcctttcccgggaa
aagatccccgggtttgtcgttatcggcatcatctcgaccatccttgacctgggtctcctc
tacggcctcaccgaatatttccatatctggtatctcctgtccgcaacagtctcgtacagt
tgcgggatggttctcaattttctcttaaacaagttcctcaattttcaggatacgagccgg
cattacctctggcagtttgtcacctttgccctgatctcctcgaccggccttgccctgaca
ctcggggttctctatattgcagtcgagatcttctcgcaaaactaccttgtcgcaaaactc
atcgcgatcattctgtcctttgcctggaactatcttggccagagcaggatcacgttctct
ttagggaaacaccggatcagcggcgaccggagagattacctgcgataa

DBGET integrated database retrieval system