KEGG   Methanoregula boonei: Mboo_1599Help
Entry
Mboo_1599         CDS       T00578                                 

Definition
(GenBank) hypothetical protein
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF308 Oxidored_q2 IncA DuoxA Phage_holin_3_6
Motif
Other DBs
NCBI-ProteinID: ABS56116
UniProt: A7I8Q5
Position
1670737..1670925
Genome map
AA seq 62 aa AA seqDB search
MSKMVMVAVWILIGLLLIIAGVTSMMTLYITGICLILAGLLIIIVAIKKALWKKPEMMAP
AK
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatggtaatggtcgcagtgtggattttgatcgggcttctcctgattattgcc
ggagtcacaagtatgatgacgctctatataacaggtatctgcctgatccttgcaggactt
ttgatcatcatcgtggcaatcaagaaggcgctctggaagaaaccggaaatgatggcgccg
gcaaaataa

DBGET integrated database retrieval system