KEGG   Methanoregula boonei: Mboo_1605Help
Entry
Mboo_1605         CDS       T00578                                 

Definition
(GenBank) GrpE protein
  KO
K03687  molecular chaperone GrpE
Organism
mbn  Methanoregula boonei
Brite
KEGG Orthology (KO) [BR:mbn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mbn03110]
    Mboo_1605
   03029 Mitochondrial biogenesis [BR:mbn03029]
    Mboo_1605
Chaperones and folding catalysts [BR:mbn03110]
 Heat shock proteins
  HSP24
   Mboo_1605
Mitochondrial biogenesis [BR:mbn03029]
 Mitochondrial protein import machinery
  Matrix
   MMC/PAM proteins
    Mboo_1605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GrpE DUF1451
Motif
Other DBs
NCBI-ProteinID: ABS56122
UniProt: A7I8R1
Position
1679142..1679630
Genome map
AA seq 162 aa AA seqDB search
MEDIEELKKELAEQTRLAEERLNQLQYLQADFDNFRRWSAKEKETITALANEKLIHDLLV
ILDDFELALPSLEQEKNREGMTMIYKKFAKILSDYGLQPIECVGKKFDPHYHEVLCTEKC
PQEQNTILEDFGKGYQLKSKVIRPSKVKIAEHVTEKVGENNG
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggaagatattgaagagctcaaaaaggaactcgcagaacagacccggcttgctgaggaa
cgcctcaatcagctgcaatacctccaggcagatttcgacaatttccgcaggtggagtgca
aaggaaaaggagacgatcaccgcccttgcaaacgagaaactgatccacgatctcctggtt
atcctcgacgatttcgagctggccctgccttccttagagcaggagaaaaaccgggaagga
atgaccatgatctataaaaaatttgcaaaaatcctgtccgactatggattgcaaccgata
gaatgcgtgggaaaaaaattcgatccccattaccacgaagtactttgtacagaaaaatgc
ccgcaggagcagaacacgatccttgaagacttcgggaaaggctaccagttgaaatccaaa
gtcatcaggccctcgaaagtaaagattgcagaacatgtaacagagaaagttggtgagaac
aatggctaa

DBGET integrated database retrieval system