KEGG   Methanoregula boonei: Mboo_1612Help
Entry
Mboo_1612         CDS       T00578                                 

Definition
(GenBank) protein of unknown function DUF100
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mbn  Methanoregula boonei
Pathway
mbn00010  Glycolysis / Gluconeogenesis
mbn00030  Pentose phosphate pathway
mbn00051  Fructose and mannose metabolism
mbn00680  Methane metabolism
mbn01100  Metabolic pathways
mbn01110  Biosynthesis of secondary metabolites
mbn01120  Microbial metabolism in diverse environments
mbn01130  Biosynthesis of antibiotics
mbn01200  Carbon metabolism
mbn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mboo_1612
   00030 Pentose phosphate pathway
    Mboo_1612
   00051 Fructose and mannose metabolism
    Mboo_1612
  09102 Energy metabolism
   00680 Methane metabolism
    Mboo_1612
Enzymes [BR:mbn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Mboo_1612
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Mboo_1612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: ABS56129
UniProt: A7I8R8
Position
1687166..1688263
Genome map
AA seq 365 aa AA seqDB search
MPKTTISVIKADVGSFPGHSRAHPKLLETAAQMLRAERGKLLLDSFVTHCGDDLELVMTH
SHGANSEAVHRLAWNVFAECTKVAKRFKLHGAGQDLLAEAFTGDIRELGPGVAEMEFEER
ESDPVLIFMADKTGPGAWNFYLYKIFADPFNTPGLVLDPALSGGFVFEVHDTVAKRMITF
SCPEESYSLLAYIGSSSRYVIKYVFKRDGTIVASTSTQRLNLTAGKYVGKDDPVMIVRAE
SGFPSMGEVLEPFTVPVLVAGWMRGSHNGPLLPVGLCDANCTRFDGPPRVVCFGFQVANG
ALVGPADIFDDPAFDRVRARCNELADTIRAQGPFEPHRLSAGEMEYTTLPAVEKELENRW
KLLKE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagaccaccatctccgttattaaggcagatgtaggaagtttccccggccattcc
cgcgcccatcccaagctgcttgaaaccgcggcgcagatgctcagggccgagaggggaaaa
ctcctccttgattcctttgtcacccactgcggcgatgatctcgaactggtcatgacccat
tcccatggggccaacagcgaggccgttcaccgccttgcgtggaatgtttttgccgaatgc
acaaaagttgcaaagagattcaagctgcacggtgccggccaggacctccttgccgaagcc
ttcacgggcgatatccgggaactcggcccgggcgtggccgagatggaattcgaggaacgg
gagtccgatcccgtccttatcttcatggcggacaagacagggcccggggcatggaatttt
tacctgtacaagatctttgccgatcccttcaacacccccgggcttgtcctcgacccggcg
ctctccgggggatttgtcttcgaggtgcatgacaccgtggcaaaacggatgatcacgttc
tcctgccccgaggaaagttacagcctgcttgcctatatcgggtcatcatcgcggtacgtg
atcaagtatgtgtttaaacgggatgggacgattgtggcttccacgagcacccagcgcctc
aaccttaccgcaggaaaatacgtgggaaaagatgatcccgttatgatcgtccgggcagag
agcggttttccctctatgggcgaggtgcttgaacccttcacggtcccggtgcttgtggcc
ggctggatgcgcggctcccacaatggcccgctcctgccggtcggactctgcgatgccaac
tgcacccggtttgacggccctccccgggttgtctgcttcgggttccaggtggcaaacggg
gcccttgtcggcccggctgacatattcgatgaccccgcgtttgaccgggtaagggcacgg
tgcaacgaactcgccgatacgatccgggcgcaggggccctttgaaccccaccgcctttct
gccggggagatggagtacaccacgcttcccgcagttgaaaaggagctggaaaaccgctgg
aaactgctcaaagaataa

DBGET integrated database retrieval system