KEGG   Methanoregula boonei: Mboo_1616Help
Entry
Mboo_1616         CDS       T00578                                 

Definition
(GenBank) putative PAS/PAC sensor protein
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DisA_N PAS PAS_9 PAS_4 Response_reg PAS_8 PAS_3
Motif
Other DBs
NCBI-ProteinID: ABS56133
UniProt: A7I8S2
Position
1689688..1691367
Genome map
AA seq 559 aa AA seqDB search
MISVLFVDDNTEFLAQFRPVLEKTGEMKLEVVASTKQAIEKLKNRAFDVIVCYEDISPVN
GIDFVPDMDGVGFLRYLRSMGNPTPVLLFHRKSESRVAFAEVSNGSEIAIPRAADLRSPA
ADLLTLIRQAALRKKAERDIKAQNDQLTAILSATPLGIFNMKNGIIEWVNHPLTALLGVP
ESSIVGKPVRSLFVTEEEYVQVCRDLQIRRDVLGNGCADCELVRPGGSILPCTLQARLLD
PLDAKKGGTVVVTDISERKKMRDALKESEAKYREMMQNAQSIIVRMDMQGTITYVNTYAA
AFFDYPEAGLVGKNVVGTIAPEKNRGGHDLSMMANDLGFNAEGYAINVSENIRRNGDIVW
IAWINKAIRDPQGHIVEVLCIGHDITDRKRSGEVRISTDTWKDQVVADTDVREEVFDSVF
HICTEISIEGREGKPVGTTFLIGDTKNVLAKSRQIMLNAFEGHVPEMRMVTNPDLKENIK
EFAQLDGAFVVSGDGFIEASGRYITVDSSKVTLPKGMGTRHNSVAAITSVTRAVGIVVSQ
SGGGITIFKNGLILKKITL
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgatctctgtcctgtttgtcgatgacaataccgagttccttgcgcagttccgcccggtc
cttgaaaagaccggcgagatgaagcttgaggtggtggcctccaccaagcaggcaatcgag
aaactcaagaaccgggcctttgatgtgattgtctgttacgaggacatctcgccggtcaac
ggcatcgattttgtccccgacatggatggcgtcggctttttgcgatacctccgctccatg
ggaaaccccacaccggtcctcctttttcatcgtaaaagcgagagccgggtggcttttgcc
gaggtcagcaacggctcggagatcgccattccccgcgctgctgacctgcgttcaccggca
gcagatctcctcacgctcatcaggcaggctgcgctaagaaagaaagccgagcgcgacatc
aaggcgcagaacgatcagctcaccgcgattctctcggcaacgcctcttggaatcttcaac
atgaagaacgggatcatcgaatgggtcaaccatccgctcacagcccttcttggagtcccg
gagtcctcgatcgtgggaaaaccggtccgctcgcttttcgtaaccgaggaggaatacgtg
caggtctgccgggacctccagatccgccgggacgtgctcgggaacgggtgtgctgactgc
gaacttgtccgcccgggcgggagcatccttccttgcactctccaggccaggcttcttgac
ccgcttgatgcaaaaaaaggcggtaccgttgtcgtcaccgacatctccgagcggaaaaag
atgcgcgatgccctcaaggagagcgaggcaaagtaccgcgagatgatgcagaatgcccag
agcatcatcgtgcgtatggacatgcagggcacgatcacgtatgtcaacacctacgcggcg
gcgttcttcgattaccccgaggcaggccttgtcgggaagaacgtggtcgggaccatagct
cccgagaagaaccggggcggccatgatctctcgatgatggcaaacgatctcgggttcaat
gccgaggggtacgcgatcaacgtcagcgagaatatccggcggaacggggatattgtctgg
atcgcgtggatcaacaaggcgatccgcgacccgcagggccatatcgtggaagtgctctgt
ataggtcacgatatcaccgaccggaaacggagcggggaagtacggatcagcaccgatacc
tggaaagaccaggtggttgcagataccgatgtgcgcgaagaggtctttgattccgtcttc
catatctgcaccgagatctcgatcgagggcagggaaggaaaaccggtgggcacgaccttt
ttgatcggcgacaccaaaaacgtgcttgccaagtcccgccagatcatgctcaacgccttc
gagggccatgtccccgagatgcgcatggtcaccaaccccgacttaaaggagaacatcaag
gagtttgcccagcttgacggggcattcgtggtctcgggcgacgggttcatcgaggcttcg
ggacggtacatcacggtggattcaagcaaggtgacgctccccaagggcatgggcacccgc
cacaactcggttgccgcaataacaagcgtgacaagggccgtgggcatcgtggtctcccag
agtggcggcgggatcacgatcttcaagaacgggctgattttgaagaagatcacgctatga

DBGET integrated database retrieval system