KEGG   Methanoregula boonei: Mboo_1624Help
Entry
Mboo_1624         CDS       T00578                                 

Definition
(GenBank) glutamate--cysteine ligase, GCS2
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCS2 GCS
Motif
Other DBs
NCBI-ProteinID: ABS56141
UniProt: A7I8T0
Position
complement(1700401..1701513)
Genome map
AA seq 370 aa AA seqDB search
MTVGTEHEYSINDAHFTALPVSDQIIKAICGRFESEIRFGEVNLGKELQKSVIEFVPRTP
ASGPAALEAQIFSGIEKFYRVFPARYHLLGLGMHPTLTLDRAIVWDHDEGEYYEAYDRLF
NIRQHGWLNIQALQINLSYAGEKDLLVQYNRIRTLLPYLIALSASSPMVEGRLTGAMDNR
LLFYRENQKEIPGICSGIIPARLSSVAEYKSAQEVIYTELRERDAAILCEEWLNSSGLII
RFSRQCLEIKALDEQECVRSDMAFVAFVSSLLRCTTLPVESDQDSLLALTETAIRQGTAG
LLPELEALYSHAWRKATAEERQYLPVIKERIAKGSLAEQIAERYRKEQAIEPVLADLAQC
LRANRPYGAE
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcggaacagagcacgagtactcgatcaacgatgcgcactttacagcgctcccg
gtctccgaccagatcataaaggcgatctgcgggcggttcgagagcgagatccggtttggt
gaagtaaatctgggaaaagagctccagaagagcgtgatcgagtttgtcccgcgcacgccg
gcctccggtcctgcagcgcttgaggcccagatcttttccggcatagaaaagttttaccgg
gtttttcctgcccggtaccacctccttgggctggggatgcacccaacacttacccttgac
cgggctattgtgtgggaccatgacgagggagagtactacgaggcctatgaccggctcttc
aatatccgccagcacgggtggctcaatatccaggcgctccagatcaatctctcctatgcc
ggggaaaaggacctgctcgtgcagtacaaccggatccgaaccctgctcccgtaccttatc
gcgctttcggcctcctctcccatggtcgagggaaggctgaccggggccatggacaaccgg
ctcctcttttaccgcgagaaccagaaagagatcccggggatctgcagcgggatcatcccg
gcccggctttcatctgttgcagagtacaaatctgcgcaggaagtgatctatacagagctc
cgggaacgggatgcggcaatcctctgcgaggagtggctcaattcaagcggccttatcatc
cggttctcccggcagtgcctggagatcaaggcgcttgacgaacaggagtgcgtccgctcg
gacatggcatttgtggcattcgtctcctcccttctccgctgtacaacccttccggtggag
agcgaccaggactcgctccttgcgcttaccgaaacagcgatccggcagggtacggccggc
ctcttgcccgaactggaagcgttgtactctcatgcctggcgaaaggcaacagccgaggaa
cggcagtatctcccggttatcaaagagcggattgccaaaggcagccttgccgagcagatc
gcagaacgataccggaaggaacaggcgatcgagcctgtccttgcagatcttgcgcagtgc
ctgcgggcaaaccgcccgtacggggcagagtaa

DBGET integrated database retrieval system