KEGG   Methanoregula boonei: Mboo_1625Help
Entry
Mboo_1625         CDS       T00578                                 

Definition
(GenBank) protein of unknown function UPF0153
  KO
K06940  uncharacterized protein
Organism
mbn  Methanoregula boonei
Brite
KEGG Orthology (KO) [BR:mbn00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Mboo_1625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CxxCxxCC IF3_N
Motif
Other DBs
NCBI-ProteinID: ABS56142
UniProt: A7I8T1
Position
complement(1701510..1702007)
Genome map
AA seq 165 aa AA seqDB search
MTEDWLLRAEAICMACGGHCCDEAHPPVSQERYRALIAAGIPAASFERKEGYFRLRTHKD
NTCILMVDHKCTCHAIKPETCRAGPFTFDVVNDTIRIFLKQASICPIVPLLKEQPAAYHQ
QYERAAENIVRLVSGLPKEEIEAINRIEEPETDLVAVIPREHPPV
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagactggctgcttcgtgccgaagctatctgtatggcctgcgggggacactgt
tgcgatgaggcacatcccccggtttcgcaggaacggtaccgtgccctgattgctgccggc
atcccggcagcatcgtttgagcggaaggaaggctatttccggctccggacccacaaggac
aatacctgtatcctcatggtggatcacaaatgcacctgccatgcgatcaagcccgagacc
tgccgggccggtccttttaccttcgatgtggtaaacgacaccatccggatctttttaaaa
caggcatccatatgcccgattgtcccgctccttaaggaacaacctgcggcgtaccaccag
cagtacgaacgggcggcagagaatattgtccggcttgtttccggcctccccaaagaagag
atcgaggcgatcaaccggatcgaggaacccgagaccgatctcgtggcggttattccacgg
gaacaccccccggtatga

DBGET integrated database retrieval system