KEGG   Methanoregula boonei: Mboo_1629Help
Entry
Mboo_1629         CDS       T00578                                 

Definition
(GenBank) protein of unknown function DUF475
  KO
K09799  uncharacterized protein
Organism
mbn  Methanoregula boonei
Brite
KEGG Orthology (KO) [BR:mbn00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Mboo_1629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF475 TerC DUF4491
Motif
Other DBs
NCBI-ProteinID: ABS56146
UniProt: A7I8T5
Position
1704638..1705561
Genome map
AA seq 307 aa AA seqDB search
MEILSILLTIAGLCLFETITSIDNAIINAEVLSTMSQKARRWFLIWGLLFAVFVIRGVLP
WLIVWASAPSLGPVGALTATFSSDPAVVAAIAQAAPILLVGGGTFLIFLFLHWIFLEEKE
YGICGERYIATKGVWFFAVVSIFLAGLVWLAISKNPMMAFGAVVGSSAFFIVHGFRQNAE
EHERKMVSGDLSDISKIFYLEIIDATFSIDGVMGAFAFTMAVPLIIIGNGIGALIVRELT
VRNVDTIRNYRYLKNGAMYSILILGIIMILDGFGAGIPEYVSPIATFGIVGYFLYRSIRA
APPAGTT
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggagattctttcgattctcttaaccatcgccgggctctgcctttttgagacgatcaca
agcattgacaatgccattatcaatgccgaggttctctccaccatgtcgcaaaaggcacga
cggtggttcctgatctggggtctcctttttgccgtctttgtgatccggggcgtgctgccc
tggctgattgtctgggcctcagcaccctcgcttgggccggttggcgcactcaccgcaacc
ttttctagcgaccccgcggttgttgccgcaatcgcccaggccgccccgatccttcttgtg
ggcggcgggacattccttatcttcctctttttacactggatctttttagaggagaaggag
tacgggatctgcggcgagcgttatatcgctacaaagggtgtctggttctttgccgtggtc
tcaatcttccttgccggccttgtctggcttgccataagcaaaaatcccatgatggccttt
ggtgcggttgtgggctcctcggcatttttcattgtgcacgggttccggcagaatgcagag
gagcatgagagaaaaatggtctcgggcgatctctccgatatcagcaagatcttttacctg
gagatcatcgatgccacattctccatcgacggggtcatgggagccttcgcgtttaccatg
gcagtcccgctcatcatcataggtaacgggattggtgccctgattgtccgggaactgacc
gtaaggaacgtggacacaatccggaattaccggtacctgaaaaacggggccatgtattcc
atcctcattttgggcattatcatgatcctggatggctttggcgccggcatccctgagtat
gtctccccgatcgccacttttggcattgtcgggtatttcctgtaccgctccatccgggca
gccccgccggccggtactacgtaa

DBGET integrated database retrieval system