KEGG   Methanoregula boonei: Mboo_1637Help
Entry
Mboo_1637         CDS       T00578                                 

Definition
(GenBank) cobalamin (vitamin B12) biosynthesis CbiM protein
  KO
K02007  cobalt/nickel transport system permease protein
Organism
mbn  Methanoregula boonei
Pathway
mbn02010  ABC transporters
Module
mbn_M00245  Cobalt/nickel transport system
mbn_M00246  Nickel transport system
Brite
KEGG Orthology (KO) [BR:mbn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Mboo_1637
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mbn02000]
    Mboo_1637
Transporters [BR:mbn02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Cobalt transporter [MD:M00245] [OT]
    Mboo_1637
   Nickel transporter [MD:M00246] [OT]
    Mboo_1637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CbiM DUF3278
Motif
Other DBs
NCBI-ProteinID: ABS56154
UniProt: A7I8U3
Position
1714932..1715660
Genome map
AA seq 242 aa AA seqDB search
MHIPDGYLGPTTFITMYLIMIPIWLYAGYWVQKNLRSRQVPYLALAAAFSFVIMMFNVPV
PGGSSGHAVGSALVAIILGPWAAVVTTSVALLIQCLVFGDGGITAFGANCFNMGTVIPFV
GYFLYKLIAGKSAIASTRRIIAAALGGYFGLGIAAGVAGFEMGLQPILEHTASGTPLYMP
YGLNVTVPAMLIDHFGFFCWVELIVTGLAFAYIARNSPDVIFNYKEIEKNSKPEARPVAT
PA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcatatacctgatggatacctgggtccaacgacctttatcaccatgtacctgattatg
atcccaatctggctatacgccggatactgggttcagaaaaatctccggtcccggcaggtg
ccgtaccttgcgctggcagctgcattctcttttgttatcatgatgttcaatgtaccggtt
cccggtggcagttcggggcacgcggtcggcagcgctctcgtggcgatcatccttggcccc
tgggcagcagtcgtaacaacatccgtcgcgctcctcatccagtgtcttgttttcggggat
ggagggattacggcatttggggcaaactgtttcaacatgggcacggtcatcccgttcgtg
gggtacttcctctacaaactgattgccgggaagtccgctattgcctcaacccggaggatc
attgccgcggcgcttggcgggtacttcggactgggtatcgctgcaggtgttgcagggttc
gagatgggccttcagccaattctcgaacatacggcatcgggtacccccctctacatgccg
tacgggctcaacgttaccgtacctgcgatgctgatcgatcatttcggtttcttctgctgg
gtagaattgattgtaaccggcctggcatttgcatacattgcaagaaacagtccggatgtc
atcttcaattataaagaaattgaaaagaattcgaaaccggaggcccgaccggtggcaaca
ccggcgtaa

DBGET integrated database retrieval system