KEGG   Methanoregula boonei: Mboo_1643Help
Entry
Mboo_1643         CDS       T00578                                 

Definition
(GenBank) putative transcriptional regulator, CopG family
  KO
K07722  CopG family transcriptional regulator, nickel-responsive regulator
Organism
mbn  Methanoregula boonei
Brite
Transcription factors [BR:mbn03000]
 Prokaryotic Type
  Ribbon-helix-helix
   CopG family
    Mboo_1643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NikR_C RHH_1 HicB_lk_antitox RMMBL
Motif
Other DBs
NCBI-ProteinID: ABS56160
UniProt: A7I8U9
Position
1720916..1721338
Genome map
AA seq 140 aa AA seqDB search
MTLENDLSRIGISLPKNLLDRFDEIINARGYSSRSEGIRDAIRTYITYYKWMADVKGERE
GVITMVYDHDQRGLLTTITDIQHEFHEIIKASLHSHVTHNRCLEVILVHGDGGQLKALAE
RLMSQKGVESVKLTTIQIEE
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgacactcgaaaacgatctctcccgcatcgggatctcccttcccaagaacctgcttgac
cggtttgacgaaattatcaatgcccggggatactcctcccggtctgagggtattcgcgac
gcgatccgtacctacatcacttattacaagtggatggcggatgtcaaaggcgagcgtgaa
ggagtgatcacgatggtctacgatcatgaccagcgcggtcttcttaccacaattacggat
atccagcacgaattccacgagattatcaaggcatcccttcattcgcatgtgacccataac
cggtgcctggaagtaattcttgtccatggcgatggaggacagctcaaggcgcttgccgaa
cgactgatgtcccagaaaggtgttgagtccgtgaaactgacaactattcagattgaagaa
taa

DBGET integrated database retrieval system