KEGG   Methanoregula boonei: Mboo_1650Help
Entry
Mboo_1650         CDS       T00578                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2178 DUF3329 DUF4173 Colicin_V O_anti_polymase PHO4
Motif
Other DBs
NCBI-ProteinID: ABS56167
UniProt: A7I8V6
Position
complement(1727028..1727489)
Genome map
AA seq 153 aa AA seqDB search
MKKNIFYLMTGLVAVVLLAIFWYSVENFTPLFFTIAFVAGIVLLYLAYRKVEDFIEDERS
ARITEKAATRTLQVFWVCFCAFSILAVMNLLDMPRFSRAFWLNRGTAVVPPEVLPLKLIG
YFQLALLCLMIFLYVGFRIYYARKFGDWESDEE
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaacatcttctacctgatgaccggtctcgtcgcagttgtgctgctggcgatc
ttctggtattcagtagaaaattttaccccgctgttttttacgatcgcttttgtggcaggc
atcgttcttctttaccttgcctaccggaaggtcgaggattttattgaggacgaacggagt
gcacggatcaccgaaaaggctgccacacggacacttcaggttttctgggtctgcttctgt
gcgttttcaatcctcgccgtgatgaacctgcttgacatgccccgtttttcccgtgcattc
tggctgaatcgcggaaccgcggtagttcctccggaagtattgccgctgaaactgattggc
tacttccagctggcattgctctgcctgatgatcttcctgtatgtcgggttcaggatctac
tacgcacgaaagttcggggactgggagtccgatgaagaataa

DBGET integrated database retrieval system