KEGG   Methanoregula boonei: Mboo_1653Help
Entry
Mboo_1653         CDS       T00578                                 

Definition
(GenBank) protein of unknown function DUF125, transmembrane
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VIT1 COQ7 Oxidored_q3 HDC
Motif
Other DBs
NCBI-ProteinID: ABS56170
UniProt: A7I8V9
Position
complement(1730371..1731246)
Genome map
AA seq 291 aa AA seqDB search
MTLTAPSLARIARLQRNEITEHHIYQRIAQVTPDPHNREVLLRIAGEEIRHYATWKHYTG
RDIAPNLLRIWFYYLIARLLGMTFAIKLMEGVEQGAQIGDPALLSAIPELPAMLADEAKH
ERELIALIDEERLKYVGSVVLGLNDALVEFTGTLAGLTFAIQDSRIIAVAGLITGVAASL
SMAASEYLSQRSDESAGTSPKKAAFYTGITYIATVALLILPFLLLASPYVALVFTLVGAV
LVIFVFTFYIAVAKDLPFWRRFAEMAAISLGIAAISFVIGLLIRVLLNVNV
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgaccgcaccatctcttgcaaggatcgcccgtctccagagaaatgagattacc
gaacaccatatttaccagaggatcgcgcaggtgaccccggatcctcacaaccgtgaggtc
ctgctccgcattgccggggaagaaatccggcattatgccacctggaagcactataccggc
cgggacatcgcccccaacctcctccggatctggttttactaccttattgcccggttgctc
gggatgacctttgccataaaactcatggagggggtggagcagggagcgcagatcggagat
cccgcgctcctctccgcaatacccgaactaccggcgatgcttgccgatgaggcaaagcac
gagagggaacttatcgccctcatcgatgaggaacgactgaagtacgtgggctcggtggtc
ctgggcctcaacgacgcgcttgtggagttcaccggtacccttgccggcctgacatttgcg
atccaggattcacgcattatcgcggttgccgggctgattaccggtgttgccgcatccctc
tccatggctgcatccgaatatctctcgcagcggtctgatgagtcagccgggaccagtccg
aaaaaggccgcattttataccggtattacctatatcgcgaccgttgccctgctgatcctt
ccgttcctccttcttgcaagcccatacgtggcgctggtcttcactcttgtcggtgcagtg
ctggtcatctttgtgttcaccttctatattgcggtggcaaaagatctccccttttggcgg
cgttttgccgagatggctgcgatcagcctggggattgcggcgatctcctttgtcataggg
ctcctgatccgggtgctgctgaacgtgaacgtatga

DBGET integrated database retrieval system