KEGG   Methanoregula boonei: Mboo_1658Help
Entry
Mboo_1658         CDS       T00578                                 

Definition
(GenBank) PfkB domain protein
  KO
K22026  nucleoside kinase [EC:2.7.1.73 2.7.1.213 2.7.1.-]
Organism
mbn  Methanoregula boonei
Pathway
mbn00230  Purine metabolism
mbn00240  Pyrimidine metabolism
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mboo_1658
   00240 Pyrimidine metabolism
    Mboo_1658
Enzymes [BR:mbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.73  inosine kinase
     Mboo_1658
    2.7.1.213  cytidine kinase
     Mboo_1658
    2.7.1.-  
     Mboo_1658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: ABS56175
UniProt: A7I8W4
Position
complement(1735432..1736328)
Genome map
AA seq 298 aa AA seqDB search
MIHVVGHTAVDHISKVHHLPEPNKSTHITDRQVFFGGGAANIAAGIATLGEQVTLHSCVG
DDFSGSAYEKWMDGLGIRRQFFEVPGTHTPTAFMFTDDAGSQMTFFEWGASAAFATAEAP
ALPLVHMATADPEFNCRVAEKSEFVSFDPGQDVFWYTKEQLDSILANTDLLFANQHEVKQ
MCATLGVTKEALVDSVTLAVFTMSGDGSRLYADGKEHFVPAVPVTLCDPTGAGDAYRSGF
LSAYVRGHSPLDCCRVGTVTASYVVEHAGCQTHLPTWTQMLERYRKHFGTLEPVPAQG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgatccatgtagtaggccacaccgcggtcgatcatatctcaaaggtacatcacctcccg
gagcccaacaagtccacccatatcacagaccgtcaggtttttttcggtggcggtgcagcc
aatattgcggcagggatcgctacccttggtgaacaggtgacgcttcattcctgtgtcggt
gacgacttttccggcagtgcttatgaaaaatggatggacgggctgggtatccgccggcag
tttttcgaggtccccggcacgcatacgccgacagcctttatgtttactgacgatgcgggc
agccagatgaccttctttgaatggggggcatcagcggcatttgcgaccgcggaggccccg
gcgctccctttagtccacatggcaactgctgatcccgagttcaactgccgggtggcagaa
aagagcgaatttgtctcgtttgatccgggacaggatgttttctggtacacaaaagaacaa
cttgattcaatcctggcaaacaccgatctcctttttgccaaccagcacgaggtaaagcag
atgtgtgccacgctcggggtgacaaaagaggcactcgtcgatagtgtcacactggcggtc
tttaccatgagcggggatggaagtcgcctgtacgctgacggtaaagagcattttgtcccg
gcagtcccggtcacgctctgtgacccgacgggcgcaggagatgcataccgctccggcttc
ctgtccgcatatgtgagggggcattccccgctggactgctgccgggttgggaccgtgacc
gcgtcctacgtagtcgagcacgccggctgccagacccatctgcccacctggacgcagatg
ctcgaacgctaccggaaacacttcggcactcttgaacctgtgccggcacagggataa

DBGET integrated database retrieval system