KEGG   Methanoregula boonei: Mboo_1659Help
Entry
Mboo_1659         CDS       T00578                                 

Definition
(GenBank) Protein of unknown function DUF555
  KO
K09731  uncharacterized protein
Organism
mbn  Methanoregula boonei
Brite
KEGG Orthology (KO) [BR:mbn00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Mboo_1659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF555 DUF4931 Init_tRNA_PT
Motif
Other DBs
NCBI-ProteinID: ABS56176
UniProt: A7I8W5
Position
complement(1736325..1736663)
Genome map
AA seq 112 aa AA seqDB search
MPDYLVTLESAWYIKEAKTLDDAIGIAISEAGKRLNPSAKFVEVEAGMLACPFCERELSS
AIVVADTALVGLILEMKVFRAESKEHASRIAKSVIGKALHEIPLKLLDVQEL
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgcctgactatctggtaactcttgaatcagcgtggtatatcaaggaagcaaagacgctt
gacgatgcaatcgggatcgcgatcagtgaggcgggaaaacgccttaatccctcggcgaag
tttgtcgaggtcgaggcaggtatgcttgcctgcccgttctgcgagcgggaactctccagc
gccattgttgttgccgataccgcgctcgtgggccttatcctggagatgaaagtgttccgt
gccgagtcaaaggagcacgccagccggattgcaaaatcggtgatcgggaaagcccttcac
gagatcccgttgaagctgctggatgtgcaggaactatga

DBGET integrated database retrieval system