KEGG   Methanoregula boonei: Mboo_1665Help
Entry
Mboo_1665         CDS       T00578                                 

Definition
(GenBank) Protein of unknown function DUF137
  KO
K09722  4-phosphopantoate---beta-alanine ligase [EC:6.3.2.36]
Organism
mbn  Methanoregula boonei
Pathway
mbn00410  beta-Alanine metabolism
mbn00770  Pantothenate and CoA biosynthesis
mbn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mboo_1665
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Mboo_1665
Enzymes [BR:mbn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.36  4-phosphopantoate---beta-alanine ligase
     Mboo_1665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PPS_PS Glyco_trans_4_4 CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: ABS56182
UniProt: A7I8X1
Position
complement(1739854..1740585)
Genome map
AA seq 243 aa AA seqDB search
MIPHDHPRYQSLVTREHLAECARSGIVSWEGLISHGRGEAFDYLLGEKTSDSARRAARVA
AALLRTARYPVISVNGNTAALAAREIAGLQKASGALVEVNLFHRTPERVAQIESLLCDAG
ADVFSGEAERLLPLSHDRAWCRRDGMYRADVVLVPLEDGDRCGVLVEMGKKVIAIDLNPL
SRTARTATLTIVDEVTRALPLIAEACATLSAEECRELVAMLDNRVFLKEAGIEMAGRLSH
ALD
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgcacgaccatccgcggtaccagtcgcttgtcacccgggagcaccttgcagag
tgtgcacgatcgggaattgtctcatgggaaggtctcatctcccatggtcgcggcgaggcg
ttcgattacctgctcggggaaaagacaagcgacagtgcacgacgggccgcccgtgtggcg
gcggccctgctccgtactgcccgctacccggttatctcggtaaacggcaatacggcggcc
ttggccgcccgcgagattgccgggctccagaaggcaagcggagcccttgtcgaggtcaac
cttttccaccggacccctgagcgtgtggcgcagatagaatccctgctttgcgatgcagga
gcggatgtcttttccggtgaagcagaacgcctgctcccgctctcgcatgaccgggcctgg
tgccggcgtgacgggatgtacagggccgatgtcgtccttgtccccctcgaagacggggat
cggtgcggtgtccttgtggagatgggaaaaaaggtgatcgcgatcgatcttaatcccctc
tcccgtactgcacggacggcaacgctgaccattgtggacgaagtgacccgggccctgccg
ctcattgcggaagcctgtgctaccctgagcgcggaagagtgccgtgagctggtggccatg
ctggacaaccgcgtttttctcaaagaggcgggaatcgaaatggcagggaggctttctcat
gctctggactga

DBGET integrated database retrieval system