KEGG   Methanoregula boonei: Mboo_1941Help
Entry
Mboo_1941         CDS       T00578                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mbn  Methanoregula boonei
Pathway
mbn00010  Glycolysis / Gluconeogenesis
mbn00030  Pentose phosphate pathway
mbn00051  Fructose and mannose metabolism
mbn00052  Galactose metabolism
mbn00680  Methane metabolism
mbn01100  Metabolic pathways
mbn01110  Biosynthesis of secondary metabolites
mbn01120  Microbial metabolism in diverse environments
mbn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mboo_1941
   00030 Pentose phosphate pathway
    Mboo_1941
   00051 Fructose and mannose metabolism
    Mboo_1941
   00052 Galactose metabolism
    Mboo_1941
  Energy metabolism
   00680 Methane metabolism
    Mboo_1941
Enzymes [BR:mbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mboo_1941
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Mboo_1941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK PEP-utilizers DAGK_cat Radical_SAM
Motif
Other DBs
NCBI-ProteinID: ABS56456
UniProt: A7I9P5
Position
2005863..2006918
Genome map
AA seq 351 aa AA seqDB search
MAFTGKIGVLTGGGDCPGLNAAIRAVVRSGIAHGYEVIGIRNGWQGLIANDIFPLSDHLV
SGIISWGGTILGTSRTDPVKNPDDIAALKRALDEQGIGALVVIGGNGTLSAAKEVAEKGV
HLVGIPKTIDNDVFGTDVTIGFDTAVAIVTEAIDRLHTTAESHHRIMILEVMGRRSGRLA
LAAGMAGGADQILVPEIQVLMNEVCSSLEARSRVGKKFSIVVVAEGTRHEDIAGTVVPAC
DRDECGHEKFVGIGNFLGKELERRLSIETRVTVLGHVQRGGSPTAHDRILATRLGIAAVE
QIHTGSFGCMVGMQEGRIVQVPLESVAGRSQGVDPKVYEEAMNVAGITEHK
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcattcacaggaaaaatcggcgtgctgactggtggcggagactgtccgggtctcaat
gcggcgatccgtgcggtggtgcgcagcggaattgcacacgggtatgaggtaatcggaatc
cggaacggctggcagggtctcattgccaacgatattttcccgctttcggatcatctggtt
tccgggattatctcgtggggaggaacaatccttggtacgtcccgtaccgatccggtgaaa
aatcctgacgatatcgcagccctcaaacgggcgctggacgagcagggcatcggagctctc
gtggtgatcgggggcaacggaaccctcagtgcagcaaaagaggtggcagaaaagggcgtc
caccttgtggggatcccaaaaaccatcgataacgatgtctttgggactgatgtcactatc
gggttcgatactgcagtagcaattgtgactgaggcgatcgacaggctccacacaaccgcg
gaatcccatcaccggattatgatactggaagtgatgggacgccggtccggccggctcgcg
ctcgcggccgggatggccgggggtgccgaccaaatcctggtaccggagatccaggtactc
atgaatgaagtctgttcgtcccttgaggcacggtcccgggtcgggaaaaaattctcgatt
gtggttgtggcagaagggacccggcacgaagatattgccggaactgtggtcccggcatgt
gacagggatgaatgtggccatgaaaagtttgtcgggattggcaatttcctgggaaaggag
ctggagcggcgtctgtccatcgagacccgggtcacggtgctcggccatgtgcagcgcggg
ggaagcccaactgcacatgaccggatccttgctacacggcttgggatcgcagcggtagag
caaatccacacgggcagttttggctgcatggtcgggatgcaggagggccggatcgtccag
gtacctctggagtccgtagctggccggtcccagggagtcgatcccaaggtatacgaagag
gcaatgaacgtggcaggaatcacggagcacaagtga

DBGET integrated database retrieval system