KEGG   Methanoregula boonei: Mboo_1945Help
Entry
Mboo_1945         CDS       T00578                                 

Definition
(GenBank) geranylgeranyl reductase
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
mbn  Methanoregula boonei
Pathway
mbn00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mbn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Mboo_1945
Enzymes [BR:mbn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     Mboo_1945
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     Mboo_1945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 FAD_oxidored FAD_binding_2 DAO Lycopene_cycl HI0933_like Pyr_redox_2 NAD_binding_8 Trp_halogenase Thi4 GIDA Pyr_redox_3 AlaDh_PNT_C Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ABS56460
UniProt: A7I9P9
Position
complement(2009699..2010895)
Genome map
AA seq 398 aa AA seqDB search
MKSKYDVLIIGGGPAGALAARTAAQKGLSVCLVEKRPAIGAPVRCAEGIGKEALAEFIPP
NPRWISAEMTGAGIVAPDGFEMTLESSMAGGKVGYILDRKVFDRELVWQAADAGADVYVK
TRASSPIMSEGRLKGAVLDYCGSSSKVTADVVIAADGVESKFGKWCGIDTTVPVREIMSS
VQYVMTDIDINPGATIFYLGNEVAPEGYLWVFPKGKRAANVGIGISGRKSGKGHRAKDYL
DKFVKQKFPHGKTIECIVGGVSVCRPLECTVADHLMLVGDAARVVDPLTGGGIYNAMYTG
KLAAEVAADCIAKGDLSKKALMIYDREWRASKMGKSIERNYHIKEYLIKQPDEKLNTIIH
SVSKLDLKEFSTLTLIKELLKANPKLLVELGALAASIR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtaagtacgatgtgctgattatcggtggtggtcctgccggggcccttgcagca
cggactgcagcacaaaaagggctctcggtctgcctggtggaaaagcgccccgcgatcggt
gcccctgtccgttgtgctgaaggcatcggtaaagaagcccttgccgagtttatcccgccc
aatccccgctggatctcagcggagatgaccggcgcgggcattgtcgcccctgatggtttt
gagatgacccttgaatcctccatggccggggggaaagtcgggtacattctcgaccgcaag
gtctttgaccgggaactggtctggcaggcggccgatgccggtgccgatgtctatgtcaag
acccgggcttcttccccgattatgagcgagggaaggctcaagggggcagtgcttgactat
tgcgggagctccagcaaagtcacggcggatgtcgtgatcgccgctgatggcgttgaatca
aagtttggcaagtggtgcgggattgacacgacagtaccggtgcgcgaaatcatgagctcg
gtacagtatgtcatgaccgatatcgacatcaatcccggcgccacgattttttatctcggt
aacgaggtggcccctgaaggatacctctgggtcttcccgaaaggaaaacgggctgcaaat
gtgggtataggtatttcaggaaggaagagtggcaaagggcaccgggcaaaagactatctc
gacaagtttgtgaaacaaaagttcccgcacggcaagaccatcgaatgtattgtaggtggt
gtctcggtctgcagacctctggagtgcacggtcgctgatcacctgatgctggtaggtgat
gcggcacgggttgtggatccgctcacgggtggtggcatctataacgcaatgtataccggc
aaactcgcggcagaggtcgcggcggattgcattgccaaaggggatctttcgaaaaaagcc
ctgatgatctacgatcgggagtggcgggcctccaagatgggtaagagcatcgagcgcaat
tatcatataaaggaatacctgattaagcagcccgatgagaaactcaacaccatcattcat
tcggtttcgaagctggacctcaaggagttctccacgctcacactgataaaagagttattg
aaggcaaatcccaagctgcttgtggaactcggggcgcttgccgcatcaatccgctga

DBGET integrated database retrieval system