KEGG   Mycobacterium tuberculosis variant bovis AF2122/97: BQ2027_MB0220Help
Entry
BQ2027_MB0220     CDS       T00132                                 

Gene name
fadD4
Definition
(RefSeq) PROBABLE FATTY-ACID-COA LIGASE FADD4 (FATTY-ACID-COA SYNTHETASE) (FATTY-ACID-COA SYNTHASE)
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
mbo  Mycobacterium tuberculosis variant bovis AF2122/97
Pathway
mbo00061  Fatty acid biosynthesis
mbo00071  Fatty acid degradation
mbo01100  Metabolic pathways
mbo01212  Fatty acid metabolism
mbo02024  Quorum sensing
Module
mbo_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:mbo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BQ2027_MB0220 (fadD4)
   00071 Fatty acid degradation
    BQ2027_MB0220 (fadD4)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BQ2027_MB0220 (fadD4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mbo01004]
    BQ2027_MB0220 (fadD4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mbo04147]
    BQ2027_MB0220 (fadD4)
Enzymes [BR:mbo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     BQ2027_MB0220 (fadD4)
Lipid biosynthesis proteins [BR:mbo01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   BQ2027_MB0220 (fadD4)
Exosome [BR:mbo04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   BQ2027_MB0220 (fadD4)
  Exosomal proteins of breast cancer cells
   BQ2027_MB0220 (fadD4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C DUF5111 PAC2 DEDD_Tnp_IS110
Motif
Other DBs
NCBI-GeneID: 1090946
NCBI-ProteinID: YP_009357550
Pasteur: Mb0220
Position
256260..257873
Genome map
AA seq 537 aa AA seqDB search
MPRGELYKRFRLVMGGIAPCGSGRRAATYPRRMQIRPYIAADKPAVILYPSGTVISFDEL
EARANRLAHWFRQAGLREDDVVAILMENNEHVHAVMWAARRSGLYYVPINTHLTASEAAY
IVDNSGAKAIVGSAALRETCHGLAEHLPGGLPDLLMLAGGGLVGWMTYPECVADQPDTPI
EDEREGDLLQYSSGTTGRPKGIKRELPHVSPDAAPGMMPALLDFWMDADSVYLSPAPMYH
TAPSVWTMSALAAGVTTVVMEKFDAEGALDAIQRYRVTHAQFVPAMFVRMLKLPEAVRNS
YDMSSLRRVIHAAAPCPVQIKEQMIHWWGPIIDEYYASSEASGSTLITAEDWLTHPGSVG
KPIQGGVHIVGADGSELPPNQPGEIYFEGGYPFEYLNDPAKTAASRNKHGWVTVGDVGYL
DDDGYLFLTGRRHHMIISGGVNIYPQEAENLLVAHPKVLDAAVFGVPDDEMGQRVMAAVQ
TVDSADANDQFAGELLAWLRDRLSHFKCPRSIAFEPQLPRTDTGKLYKSGLVEKYSV
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
ttgccacgtggagaactttacaaacgatttcggctggtgatgggcggaattgcgccctgc
ggctctggtcgccgggccgcgacgtaccctcggcgcatgcagattcgcccgtatatcgcc
gccgataagcccgccgtcatcctgtatccgtccgggacggtcatcagcttcgacgagttg
gaggcccgcgccaaccggttggcgcattggttccgccaggctggtctgcgcgaggacgac
gtcgtggccatcctgatggagaacaacgagcacgtgcacgcggtcatgtgggcggctcgc
cgcagcgggttgtactacgtgccgatcaatacccacctgaccgcctccgaggccgcctac
atcgtcgacaacagcggtgccaaagcaattgtcggttcggcggcgctgcgcgagacctgc
cacggcctggccgaacaccttccgggcgggctgccggacctgctgatgcttgccgggggc
ggtctggtcggctggatgacctacccggaatgcgttgccgatcaaccagacaccccgatc
gaggacgaacgcgagggtgacctgctgcagtactcgtcgggaacgactggccgaccgaag
ggaatcaaacgcgaattgccacacgtctcaccggatgcggcacccgggatgatgccggca
ctgctcgatttctggatggacgccgactcggtatatctgagtcccgcgccgatgtaccac
accgctccgtcagtgtggacgatgagcgcactggccgcgggcgtcaccaccgtcgtgatg
gagaagttcgacgccgagggcgccctcgacgccatccagcgctaccgggtgacccacgcg
caattcgtcccggccatgttcgtccggatgctgaaactccctgaagcagttcgtaattcg
tatgacatgtccagccttaggcgagtgatccacgcggccgctccatgtccagtccagatc
aaggagcagatgattcactggtggggaccgatcatcgacgagtactacgcctcctcggaa
gccagcgggtcgacgttgatcacagccgaggattggttgacgcatccgggttcggtcggc
aagcccatacagggcggggtgcacatcgtgggcgccgacggcagcgagctgccgccgaac
cagccgggcgaaatctatttcgagggcgggtaccccttcgaatacctcaacgatccggcg
aaaaccgcggcgtcgcgcaacaagcacggctgggtaaccgtcggcgacgtcggctatctc
gacgacgacggctacttgttcctgaccggccggcgccaccacatgatcatctccggcggc
gtgaacatctacccgcaggaggcggagaacctcttggtcgcccaccccaaggtgctcgac
gcggcggtgttcggcgttcccgacgacgagatgggtcaacgtgtcatggccgcggtgcaa
accgtcgactccgccgatgccaacgatcagttcgccggcgagctattagcctggttacga
gaccgcttgtcacacttcaagtgtccaaggtcgatcgcgttcgaaccgcaattgccgcgc
accgacaccggaaagctctacaagagcgggctggtcgaaaaatactcggtgtga

DBGET integrated database retrieval system