KEGG   Mycobacterium tuberculosis variant bovis AF2122/97: BQ2027_MB2991CHelp
Entry
BQ2027_MB2991C    CDS       T00132                                 

Gene name
pca
Definition
(RefSeq) PROBABLE PYRUVATE CARBOXYLASE PCA (PYRUVIC CARBOXYLASE)
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
mbo  Mycobacterium tuberculosis variant bovis AF2122/97
Pathway
mbo00020  Citrate cycle (TCA cycle)
mbo00620  Pyruvate metabolism
mbo01100  Metabolic pathways
mbo01120  Microbial metabolism in diverse environments
mbo01200  Carbon metabolism
mbo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BQ2027_MB2991C (pca)
   00620 Pyruvate metabolism
    BQ2027_MB2991C (pca)
Enzymes [BR:mbo01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     BQ2027_MB2991C (pca)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Biotin_lipoyl_2 Dala_Dala_lig_C RnfC_N ATP-grasp GCV_H ATP-grasp_3
Motif
Other DBs
NCBI-GeneID: 32287113
NCBI-ProteinID: YP_009360346
Pasteur: Mb2991c
Position
complement(3280764..3284147)
Genome map
AA seq 1127 aa AA seqDB search
MFSKVLVANRGEIAIRAFRAAYELGVGTVAVYPYEDRNSQHRLKADESYQIGDIGHPVHA
YLSVDEIVATARRAGADAIYPGYGFLSENPDLAAACAAAGISFVGPSAEVLELAGNKSRA
IAAAREAGLPVLMSSAPSASVDELLSVAAGMPFPLFVKAVAGGGGRGMRRVGDIAALPEA
IEAASREAESAFGDPTVYLEQAVINPRHIEVQILADNLGDVIHLYERDCSVQRRHQKVIE
LAPAPHLDAELRYKMCVDAVAFARHIGYSCAGTVEFLLDERGEYVFIEMNPRVQVEHTVT
EEITDVDLVASQLRIAAGETLEQLGLRQEDIAPHGAALQCRITTEDPANGFRPDTGRISA
LRTAGGAGVRLDGSTNLGAEISPYFDSMLVKLTCRGRDLPTAVSRARRAIAEFRIRGVST
NIPFLQAVLDDPDFRAGRVTTSFIDERPQLLTARASADRGTKILNFLADVTVNNPYGSRP
STIYPDDKLPDLDLRAAPPAGSKQRLVKLGPEGFARWLRESAAVGVTDTTFRDAHQSLLA
TRVRTSGLSRVAPYLARTMPQLLSVECWGGATYDVALRFLKEDPWERLATLRAAMPNICL
QMLLRGRNTVGYTPYPEIVTSAFVQEATATGIDIFRIFDALNNIESMRPAIDAVRETGSA
IAEVAMCYTGDLTDPGEQLYTLDYYLKLAEQIVDAGAHVLAIKDMAGLLRPPAAQRLVSA
LRSRFDLPVHLHTHDTPGGQLASYVAAWHAGADAVDGAAAPLAGTTSQPALSSIVAAAAH
TEYDTGLSLSAVCALEPYWEALRKVYAPFESGLPGPTGRVYHHEIPGGQLSNLRQQAIAL
GLGDRFEEIEEAYAGADRVLGRLVKVTPTSKVVGDLALALVGAGVSADEFASDPARFGIP
ESVLGFLRGELGDPPGGWPEPLRTAALAGRGAARPTAQLAADDEIALSSVGAKRQATLNR
LLFPSPTKEFNEHREAYGDTSQLSANQFFYGLRQGEEHRVKLERGVELLIGLEAISEPDE
RGMRTVMCILNGQLRPVLVRDRSIASAVPAAEKADRGNPGHIAAPFAGVVTVGVCVGERV
GAGQTIATIEAMKMEAPITAPVAGTVERVAVSDTAQVEGGDLLVVVS
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
gtgttttccaaggtgctcgtcgccaatcgcggggagatcgcgatccgggcctttcgtgcc
gcctacgaactgggcgtcggaaccgtggccgtttatccgtacgaggaccgcaattcgcag
caccgtctcaaggcggacgagtcttaccagatcggcgacatcggtcacccggtgcatgca
tacctgtcggtcgacgagatcgtcgcgacggcccgtcgggcgggtgccgacgctatctac
cctggctacgggtttctatcggagaatccggatctggctgcggcatgcgcggcggcgggc
atcagcttcgtcggtcccagcgccgaagtgcttgagctggctgggaataagtctcgcgcc
atcgcggcggcccgcgaagccggcttgcccgtgctgatgtcctcggcgccgtcggcctcg
gtcgacgaactgctgtcggttgcggccggcatgccgtttccgttgttcgtcaaggcagtt
gccggtggcgggggccggggtatgcgtcgtgtcggcgatatcgcggcgcttccggaggcg
atcgaagccgccagccgggaagccgagtcggcgttcggggacccgacggtctatctcgag
caggcagtgatcaatccacgccacatcgaggtgcagattctggcggacaacctcggcgac
gtgatccatctctatgagcgtgactgcagtgtgcagcgtcgccatcagaaggtcatcgag
ctggcgcccgcgccgcacctggacgccgagttgcgttacaagatgtgcgtcgatgcggtc
gccttcgcccgccatatcgggtacagctgcgcgggcaccgtcgagttcctgctggacgag
cgaggggagtatgtcttcatcgagatgaatccgcgggttcaggtggagcacacggtgacc
gaggagattaccgacgtcgacctggtcgccagccagctgcgcattgccgccggggagacg
ctcgaacaattgggcctgcggcaggaggacatcgcaccgcatggcgccgcactacagtgc
cggatcaccaccgaggatccggccaacggcttccggccggacacgggccggatcagcgcg
ttgcgcaccgccggcggtgccggtgtccgcctggacggcagcaccaacctgggcgcagaa
atcagcccgtacttcgactccatgctggtcaagctgacctgtcggggccgtgacctccct
accgcagtgagccgtgcgcgccgggcgatcgcggagttccggatccgcggggtatcgacg
aatattccgttcctgcaagcggtcctggatgacccggacttccgagcgggccgggtcacc
acgtccttcattgatgagcggccgcagctgctgaccgcgcgcgcctcggccgaccgcggc
accaagatccttaacttcctggccgatgtcaccgtcaacaacccgtatggctcgcgtccg
tcaacgatctacccggacgacaagctgcccgatcttgatctgcgggccgcaccaccggcc
gggtccaagcagcgactagtcaagttggggccggaaggatttgctcgttggctgcgggag
tcggccgcggtcggggtcaccgataccacattccgggatgctcaccagtcgttactggct
acccgagtacgcaccagcggactgtcgcgggtggcaccgtatctcgcgcggaccatgccg
cagctgttgtccgtggagtgttggggcggtgcgacttacgatgtggcgctgcgctttctc
aaggaggatccctgggaacggctggccacactgcgtgcagcaatgcccaatatctgcttg
cagatgctattgcggggccgcaataccgtgggctacacgccgtacccggaaatcgtgacg
tcggcgtttgtgcaagaagcaacagccaccggtatcgacatctttcgtatcttcgacgcg
ctcaacaacatcgagtcgatgcgtccggcgatcgacgcagtacgcgaaacaggttctgcg
atagcagaagtcgcgatgtgctacacgggcgaccttaccgatccgggtgaacagctgtac
acgctggactactacctgaaactggctgagcagatcgtggacgccggcgcccatgtgctg
gcgatcaaggatatggctggactgttgcgcccgccggccgctcaaaggttggtcagcgcc
ctgcgcagtcgcttcgacctgcccgttcacctgcacacccacgacacaccgggtggccag
ctcgccagctatgtggccgcttggcacgccggggccgatgccgtcgacggcgccgccgcg
ccgctggcgggaacgaccagccagcccgcgctgagctcgatcgttgctgccgctgcccac
accgagtacgacaccggcctgtcgctttcggcggtgtgcgccctggagccgtactgggag
gcgttacgaaaagtgtatgcgccgttcgagtctgggttgccggggccgacggggcgggtt
tatcaccacgagattccgggcggccaactgtctaatctgcgccagcaagcaattgctctt
ggtctgggagatcgattcgaagagatcgaagaggcctacgcgggcgccgaccgagtgttg
ggcaggctggttaaggtcacgccaacgtccaaggtggtcggcgatctggcgctggcactg
gtcggcgccggtgtcagtgcagacgaattcgcctccgatccagcgcgatttggcatcccg
gaatcggtactcggatttctgcggggcgagctgggtgatccgcccggcgggtggcccgaa
ccgctgcgcactgcggcgctggccggtcgcggggcggccaggcccactgcgcaattggcg
gcggacgacgagattgccctatcgtcggtcggagccaagcgtcaggccaccctgaacagg
ctgttatttcccagtccaacaaaggaattcaatgagcaccgggaagcctacggcgacacg
tcgcaattgtcggccaaccagttcttctatggtctgcgccaaggtgaagagcatcgggtg
aagctggagcgtggggtggagctgttgatcgggctggaggccatttccgaacccgacgaa
cgcggcatgcgaacggtgatgtgcatcctcaacgggcagctgcggccggtgctagtgcgc
gaccgcagcattgccagtgccgttccggccgccgagaaggccgaccgcggcaatcccgga
cacatcgccgcgccatttgccggagtcgtcacggtcggggtgtgcgtcggcgagcgggtc
ggcgccggccaaaccatcgccaccatcgaggcgatgaagatggaagccccgatcaccgcc
ccggttgccggcaccgtggagcgggtggcggtgtcggacaccgcccaggtggagggcgga
gacctgttggtggtggtgagctga

DBGET integrated database retrieval system