KEGG   Mycobacterium tuberculosis variant bovis AF2122/97: BQ2027_MB3354CHelp
Entry
BQ2027_MB3354C    CDS       T00132                                 

Gene name
moaB3
Definition
(RefSeq) PROBABLE PTERIN-4-ALPHA-CARBINOLAMINE DEHYDRATASE MOAB3 (PHS) (4-ALPHA-HYDROXY-TETRAHYDROPTERIN DEHYDRATASE) (PTERIN-4-A-CARBINOLAMINE DEHYDRATASE) (PHENYLALANINE HYDROXYLASE-STIMULATING PROTEIN) (PHS) (PTERIN CARBINOLAMINE DEHYDRATASE) (PCD)
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
mbo  Mycobacterium tuberculosis variant bovis AF2122/97
Pathway
mbo00790  Folate biosynthesis
mbo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BQ2027_MB3354C (moaB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mbo04147]
    BQ2027_MB3354C (moaB3)
Enzymes [BR:mbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     BQ2027_MB3354C (moaB3)
Exosome [BR:mbo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BQ2027_MB3354C (moaB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 32288333
NCBI-ProteinID: YP_009360715
Pasteur: Mb3354c
Position
complement(3669180..3669554)
Genome map
AA seq 124 aa AA seqDB search
MAHGNVSRCEESSLHDVCCGRLSALTDRELSERLTALPGWELVDGKLRHTFGFGSFDQSM
KFVAKIAAIADKFNHHPDICVHNKRSVRLTCWTRQMHCLTRVDFDLAEAFSAVHDEQCSQ
QVAR
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggcacacggcaacgtcagtcgatgtgaggagtcaagccttcacgacgtgtgctgcggc
aggctgtcggctctcaccgacagggagctgtccgagaggttgacggcactgcccgggtgg
gagctcgtcgatggaaagctccgccacacatttgggtttgggagcttcgatcaatccatg
aaatttgtggcgaagatcgccgccatcgccgacaaattcaatcatcaccccgatatctgt
gtccataacaagcggtcggtgcggttgacttgttggacgcgccagatgcactgtttgact
cgcgtcgacttcgacctcgccgaggctttcagcgcagtgcacgatgagcaatgcagccag
caggtggcacggtga

DBGET integrated database retrieval system