KEGG   Mycoplasma bovirhinis: CO229_01060Help
Entry
CO229_01060       CDS       T06002                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mboh  Mycoplasma bovirhinis
Pathway
mboh03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mboh00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CO229_01060
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mboh03011]
    CO229_01060
Ribosome [BR:mboh03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CO229_01060
  Bacteria
    CO229_01060
  Archaea
    CO229_01060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF226
Motif
Other DBs
NCBI-ProteinID: ATO30710
UniProt: A0A224AZ76
Position
246135..246479
Genome map
AA seq 114 aa AA seqDB search
MNKQQAKAHVKLQRVSVSKAKLVANLFRGKNVDLALGILHNTAKKSSKIFIKLLNSAIAN
ATNNHGMDASKLFVKEVYVNEGPTLKRFQPRSRGNAYSIFKRTSNLSIVLEERN
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaacaagcaaaagctcatgttaagttacaaagagttagtgtttctaaagct
aaattagtggcaaacttatttagaggtaaaaacgtagatttagctcttggtatcttacac
aatactgctaaaaaatcatcaaaaattttcattaaattattaaactcagctattgcaaat
gcaactaataatcacggtatggatgcatcaaaattattcgttaaagaagtttatgtcaat
gaaggtccaactttaaaaagatttcaaccaagaagtcgtggaaatgcttactcaattttt
aaacgtacatctaacttatcaatagtactagaggagagaaattaa

DBGET integrated database retrieval system