KEGG   Mycoplasma bovigenitalium: MBVG596_0829Help
Entry
MBVG596_0829      CDS       T05188                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mbov  Mycoplasma bovigenitalium
Pathway
mbov00450  Selenocompound metabolism
mbov00970  Aminoacyl-tRNA biosynthesis
mbov01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbov00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MBVG596_0829
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MBVG596_0829
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mbov01007]
    MBVG596_0829
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mbov03016]
    MBVG596_0829
Enzymes [BR:mbov01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MBVG596_0829
Amino acid related enzymes [BR:mbov01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MBVG596_0829
Transfer RNA biogenesis [BR:mbov03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MBVG596_0829
 Prokaryotic type
   Other AARSs
    MBVG596_0829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f tRNA-synt_1b tRNA-synt_1d Band_7_1 Anticodon_1
Motif
Other DBs
NCBI-ProteinID: BAW18427
UniProt: A0A1L7MYY5
Position
complement(585771..587309)
Genome map
AA seq 512 aa AA seqDB search
MKKTFYITTPIYYASGSLHIGHLYSTIMARTIANYKEIMGYDVKFLTGSDEHGQKIENKA
KKINKNPKEFVDSLVEEYIATWKKWFIKVDYFSRTTSKNHEKAVKNIFSWFLEKGFIYKG
QYEGLYSVEDEEFLTKSQANLVDGEYFHPTSGHKLVSMAEESYFFEISAFEKWWIEYVKN
NPEFLLPDKTLFEIKNNFVNIGLEDLSVTRTNVNWAIPINEDTKHTLYVWLDALFNYVTA
LGFDVENQGEDFKKYWENGDEIVHVLGKEITRFHFIYWPIFLKAINIKQPTHILSHGLLR
DKDGRKMSKSLGNAIDPEYLYENYHHEMIKYYFASQIIFGEDGNFSEEKLRETINSDLVN
NFGNLISRTLKMISNSFTNGVKYVASNDNLHQEIENAILTFINEFTIQMDKFKIDKGIRK
IMDLSSRLNKYIDETMPWKLTENKEELNLILNRLLNGIYAAAWALQVSMPEKIKEVAKAL
NINGFELDKINDFSKFDNVIPTEKFAFFARLK
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaactttttatataacaacacctatttattatgcatcagggtctttgcacatt
ggccacttatattcaacaattatggcaagaactatagctaactataaagaaattatgggt
tacgatgtgaaatttttgaccggttcagatgaacatggtcaaaaaattgaaaataaagca
aaaaaaataaataaaaatccaaaagaatttgttgattctcttgttgaagaatatattgca
acatgaaaaaaatgatttattaaagttgattatttttcaagaaccacttcaaaaaatcat
gaaaaagcagttaaaaacatttttagttgatttcttgaaaagggcttcatttataagggc
caatatgaaggattatattcagttgaagacgaagaattcttaacaaaatcgcaagcaaat
ttagttgatggcgaatattttcaccctacatcaggacacaaattagtttcaatggctgaa
gaaagttatttctttgaaatttcagcatttgaaaaatggtggattgaatatgtaaaaaat
aatcctgaatttttattaccagacaaaactttatttgaaatcaaaaataattttgtgaat
attggtcttgaagacctatcagttacaagaaccaatgttaattgagctattccaattaat
gaggatactaaacatactttatatgtatggttagacgctttatttaattatgttactgcc
ttaggtttcgatgttgaaaatcaaggtgaagattttaaaaaatattgagagaatggcgat
gaaatagtacacgttttaggtaaagaaataacaagattccactttatttattgacctata
tttttaaaagcaatcaatataaaacagcctacacacatattaagccatggattattaaga
gataaagatggtagaaaaatgtctaaatctttaggaaacgcaattgatccggaatattta
tacgaaaattatcaccatgaaatgattaaatattattttgcaagtcaaattatttttggt
gaagatggcaattttagtgaagaaaaattgcgtgaaacaataaattctgaccttgtaaat
aactttggaaacttaatatcaagaacattaaagatgatttcaaattcatttacaaatggg
gtgaaatatgttgcgtcaaatgataatttacatcaagaaatagaaaatgcaattttgacc
tttatcaatgaatttacaattcaaatggataaattcaaaattgataaaggtataagaaaa
ataatggacttatcttcaagattaaataaatatattgatgaaactatgccttgaaaatta
acggaaaataaagaagaattgaatttaatcttgaatagattattaaatggtatttatgca
gctgcttgagctttacaagtttcaatgccagaaaaaataaaagaagttgctaaagcacta
aatatcaatggatttgaacttgacaaaataaatgattttagtaaatttgacaatgtaatt
ccaactgaaaaattcgcattttttgcaagacttaaatag

DBGET integrated database retrieval system