KEGG   Maize bushy stunt phytoplasma: MBSPM3_v1c3500Help
Entry
MBSPM3_v1c3500    CDS       T04456                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mbp  Maize bushy stunt phytoplasma
Pathway
mbp00450  Selenocompound metabolism
mbp00970  Aminoacyl-tRNA biosynthesis
mbp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MBSPM3_v1c3500 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MBSPM3_v1c3500 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mbp01007]
    MBSPM3_v1c3500 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mbp03016]
    MBSPM3_v1c3500 (metG)
Enzymes [BR:mbp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MBSPM3_v1c3500 (metG)
Amino acid related enzymes [BR:mbp01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MBSPM3_v1c3500 (metG)
Transfer RNA biogenesis [BR:mbp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MBSPM3_v1c3500 (metG)
 Prokaryotic type
   Other AARSs
    MBSPM3_v1c3500 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 Mre11_DNA_bind
Motif
Other DBs
NCBI-ProteinID: AOF54857
Position
complement(390016..391578)
Genome map
AA seq 520 aa AA seqDB search
MKTTPNQKPKFFLSTAIAYASGIPHIGNVYESILADAIARFKRLEGFDVLFQTGTDEHGQ
KIAAKALQQGKNPQEYVDQISLEIKRIYDLMQVSYDKFVKTTNPHHKQTVQAIFYKLWQQ
GDIYLGKYQGLYSVAEESYVSAKDLIDGKTFNGETPILISEETYFFKLSKYQAQLLQYLE
NNPSLIKPDAQRKELLNLLKEPLADLSVSRTSFKWGIPVPFDPKHVIYVWIDALSNYLTG
LDYNPTSKNSQFNRYWPCDMHVIGKDILRFHLIYWPILLMALEISLPKQFLTHPWILFDK
NKMSKSKGNVLYVDDLLKYFPMDSIRYFVLSEIPYAQDGNITYELLVERHNSDLANVLGN
LVHRVFGMVKSYRQNNLSKTLITTNLDPKFDLSKQALATLPLVRLKMQDCKVGDALKEIM
NLARFANKYIDFVEPWNLFKNPEKQQLLDHTLYSLVETLRFLGVLLQPFLPQTAHKILTQ
LKNSDITFESLDTFGLLSSQKLDNYHILFNRLEIDEVLPR
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaacccccaaccaaaaacctaaattttttctttccacagcaattgcctatgct
tctggcattccgcacattggaaacgtttacgaatctattttagctgatgccattgctcgt
ttcaaacgcctagaaggatttgatgttttgtttcaaacaggaaccgatgaacacggacaa
aaaattgctgccaaagctttgcaacaaggcaaaaatccccaagaatacgtagaccaaata
tctttggaaattaaaagaatttatgatttaatgcaagtaagttacgataaatttgtaaaa
actaccaatccccaccacaaacaaacagttcaagccatcttttacaagttatggcaacaa
ggagatatttatttaggaaaatatcaagggctttattcagttgctgaagaatcttatgtg
tctgccaaagatttaattgatggaaaaacttttaatggtgaaactcctattttaatcagc
gaagaaacttatttttttaagctttccaaatatcaagcccagttattgcaatatttagaa
aacaatccctccttaattaaacctgatgcccaaagaaaagagctgttaaatttattaaaa
gaaccattagcagatttgtctgtttctagaacttctttcaagtggggcattcccgttcct
tttgaccccaaacacgttatttatgtttggattgatgctctaagcaattatctaaccgga
ctagactacaatcctacatccaaaaatagtcagtttaatcgatattggccctgtgatatg
catgttattggtaaagatattttaaggtttcaccttatctactggcctattttattgatg
gcacttgaaatttcactacccaaacagtttttaacccatccatggattttgtttgataaa
aataaaatgtctaaatctaaaggtaacgttttgtacgttgatgatttattaaaatatttt
ccgatggattccattcgttattttgttctatcagaaattccttatgctcaagatggtaat
atcacttatgaattgttagtagaaaggcacaatagtgacctagctaatgttttgggaaat
ttagttcatagagtttttgggatggtaaaaagttatcgccaaaataatttatccaaaact
ttaattacaactaatttagatcccaaatttgatttatccaaacaagctttagcaactctt
cctttggttcgtctcaaaatgcaagattgtaaagtaggagatgccttgaaagaaattatg
aatttggctcgttttgctaataaatacattgattttgtagaaccttggaatttatttaaa
aatcctgaaaaacaacaactattagaccacacactatattctttggtagaaactttaagg
tttttaggagttttattgcaaccttttttacctcaaactgctcataaaattttaactcaa
ctcaaaaactccgatattacttttgaaagtttagatactttcgggcttctttcaagtcaa
aaattagataattatcatattttatttaatcgtttggaaattgatgaagttttacctaga
taa

DBGET integrated database retrieval system