KEGG   Monosiga brevicollis: MONBRDRAFT_10003Help
Entry
MONBRDRAFT_10003  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00520  Amino sugar and nucleotide sugar metabolism
mbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MONBRDRAFT_10003
Enzymes [BR:mbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     MONBRDRAFT_10003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 Polysacc_synt_2 3Beta_HSD RmlD_sub_bind FliJ NmrA KR adh_short
Motif
Other DBs
NCBI-GeneID: 5892952
NCBI-ProteinID: XP_001747788
JGI: 10003
UniProt: A9V4W9
AA seq 450 aa AA seqDB search
MAMYQSTNRLAGLAIATLLLVVVYSAYSNPIDRDTAEQKDSVVDRERQVEQRQRELSDLR
RELSLLKNASNTRAYPEVKIRNEFDRKRILITGGAGFVGSHLVDVLMRDGHEVTVVDNFF
TGRRKNVEHWIGHPHFELVMHDVVEPYMMECDEIYHLASPASPPHYMYNPVKTIKTNTVG
TMNMLGLAKRTGARVLLASTSEVYGNPTVCLKAMQSIAFAITVPLRRRCPYVHPQPETYF
GNVNPDGPRACYDEGKRIAETMCYAYSKQSGVEVRVARIFNTFGPRMHIGDGRVVSNFII
QALQDQAITVYGEGLQTRSFQYVSDLVAGLIALMNSDFDEPVNLGNPDEYTMIDFAKHIK
EITGSSSEIIHKPATQDDPQKRKPDISRARQVLKWEPKVSVLDGLKRTIEYFRHELSAPT
TRDENKHSHGVGGPYGNTIELPYINDEKKP
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggccatgtaccaatccaccaacaggctggccggattggccattgccactctgcttctt
gtcgtcgtgtactcggcctattcaaatcccatcgaccgcgacaccgccgaacaaaaagac
tctgtcgtggatcgcgagcgacaagtcgaacagcgacaacgtgagctgtccgaccttcgc
cgcgaactctccctcctcaaaaacgccagcaacacacgcgcctacccggaagtcaagatt
cgcaatgaatttgatcgcaagcgcatccttatcactggcggtgccggctttgtcggctcc
cacttggtcgatgtcctgatgcgcgatgggcacgaagtcaccgtcgtcgacaatttcttt
actggtcgccgcaaaaacgtcgagcactggatcggccatcctcactttgagctggtcatg
catgatgtggtcgagccgtacatgatggagtgcgatgaaatttatcacctcgcctcgcct
gcctccccgccccactacatgtacaacccagtcaagacaatcaaaacaaacaccgtgggc
acaatgaacatgctgggcctagccaagcgcaccggcgctcgcgttctcttggcctctacc
tcggaagtatatggcaatcctacggtctgtctcaaagccatgcaatcgatcgcgtttgcc
atcaccgtcccgctcaggcggaggtgcccgtatgtgcaccctcagcccgaaacatacttt
ggcaacgtaaaccccgatggtccccgtgcttgctacgacgagggtaaacgcattgcggag
accatgtgctatgcctattcaaaacaaagcggtgtcgaggtgcgcgtggcccgcatcttc
aatacatttggaccgcgcatgcacatcggagatggccgcgtggtcagcaactttatcatc
caggccttgcaggaccaggccatcaccgtctatggcgaggggctgcaaacacgctccttc
caatatgtgagtgacctcgtggctggtctcattgccctcatgaactcggactttgacgaa
cccgtcaacctgggcaatccggacgagtacaccatgattgactttgccaagcatatcaag
gaaatcactggttcctcctcggaaattatccataaaccggccacccaagatgacccgcaa
aagcgcaagcccgatatctcccgtgcgcgccaggtcctcaagtgggaacccaaggtctct
gtgctcgatgggctcaaacgcaccatcgaatattttcgtcacgagctctctgcgccgacc
actcgcgacgagaacaagcacagccacggcgtgggtggcccctatggtaacaccatcgag
cttccttacattaacgatgagaagaaaccttag

DBGET integrated database retrieval system