KEGG   Monosiga brevicollis: MONBRDRAFT_15305Help
Entry
MONBRDRAFT_15305  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00450  Selenocompound metabolism
mbr00970  Aminoacyl-tRNA biosynthesis
mbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MONBRDRAFT_15305
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MONBRDRAFT_15305
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mbr01007]
    MONBRDRAFT_15305
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mbr03016]
    MONBRDRAFT_15305
Enzymes [BR:mbr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MONBRDRAFT_15305
Amino acid related enzymes [BR:mbr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MONBRDRAFT_15305
Transfer RNA biogenesis [BR:mbr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MONBRDRAFT_15305
 Prokaryotic type
   Other AARSs
    MONBRDRAFT_15305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g Anticodon_1 tRNA-synt_1 PHD_2 DZR
Motif
Other DBs
NCBI-GeneID: 5889203
NCBI-ProteinID: XP_001744032
JGI: 15305
UniProt: A9UU57
AA seq 616 aa AA seqDB search
MPKVHVRPPAPILPKAGARNILVTSALPYVNNVPHLGNIIGCVLSADVYARFARNQGHTV
LFVCGTDEYGTATETKALAEGMTPREICDKYHAIHKGVYEWFNISFDHFGRTSTPLQTEI
CQDIFKKCYANGFVQQKDEQQWYCTSCETFLADRFVEGICPDCGYDDARGDQCDECGHTF
DAIKLKSPRCRYRKDCNKAPELRTSRHLYLQLDKLQPLTEKWYAESNDKHAWSKIAQDIS
RNWFNMGLEARAITRDLKWGIPVPLEGFTEKVFYVWFDAPIGYISITANYTDQWEQWWKN
PENVELFQFMAKDNVPFHSIVFPSALLASQDNWTMLNHLNAVQYLNYEGTQFSKSRGVGV
FGDSARDSGLAADVYRFYLLYMRPEASDANFDWEDLVAKHNNELLNNLGNFANRALSFCK
RFFDGKVPKIALDDTAVEAVAQVNTELRAYTEGMESQVRIRDAIRGILSVSRIGNQYLQS
TMPWKLVKNPETAAQAGSIVGVVLNLTYLIALMLEPIMPDTAQELLQQIGAERRFLPSAF
APLLDEGHVIGEPKPLFEKIDPDMAKEWRSRYGGRQAKAPEAPKVELLPTDRKRKTWSDR
CGNRFWHPISFDSLLR
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaggtccacgtccgcccaccggcacccatcttgcccaaagcgggggctcgcaac
attcttgtcacgagtgcgctgccttatgtcaataatgtgccgcacttgggcaacattatt
ggttgcgtcctctcagccgatgtttatgcccggtttgcgcgcaatcagggccataccgtc
ctctttgtgtgcggcacagacgaatatggcacagcaacggaaaccaaggcgctggccgag
ggcatgacccctcgggagatctgcgacaagtaccacgccatccacaagggtgtttacgag
tggttcaacattagctttgaccactttggtcgcaccagcacgccgctgcaaaccgagatt
tgccaagacatcttcaaaaagtgctacgccaatggctttgttcaacaaaaggacgagcaa
cagtggtactgcacatcctgtgaaacgttcctggcagatcgttttgtggagggcatctgt
cctgattgcggctacgacgatgcccgtggagaccagtgtgacgagtgcggacacacgttt
gatgccatcaagctcaagtcgccgcgttgccgttaccgcaaggactgcaataaggcaccc
gagctgcgcacttcccgccacctctacttgcagctggataagctccagcctctcaccgag
aagtggtatgccgagtcaaacgataagcatgcctggagcaagatcgcgcaggacatctcg
cgcaactggttcaacatgggcctcgaggcacgcgccattacgcgtgacctcaagtggggc
atccctgtgccgcttgagggattcaccgaaaaggtgttttacgtttggtttgatgcgccc
attggctacatctccatcacggccaactacacggatcaatgggagcagtggtggaagaac
ccagagaacgtcgagttgttccagtttatggccaaggataacgtgccattccactccatt
gtcttcccatctgcccttctcgcatctcaggacaactggacgatgctgaatcatctgaac
gccgtgcagtacctcaactatgaaggaactcagttttccaagagccgtggggttggcgtg
tttggcgactcggctcgtgactcgggattggccgcggatgtataccgcttctatcttctc
tacatgcgacctgaagcttccgatgccaactttgactgggaggatctggtggccaagcac
aacaacgagctgctcaacaatttgggcaactttgccaaccgggctctctctttttgcaag
cgcttttttgacggcaaagtgcccaagatcgcgcttgatgacaccgctgtcgaggccgtg
gcacaggtcaacaccgagctgcgtgcctacaccgagggtatggagtcccaggttcggatc
cgtgatgccattcgtggcatcttgtccgtgtcccgcatcggcaaccaatacttgcagagc
accatgccttggaagctggtgaagaaccccgaaacagcagctcaggctggctccatcgtg
ggcgtcgttctgaatttgacctacttgattgcgctcatgctcgagcccatcatgccggac
acggcccaggagctgctgcagcaaattggtgctgagcgccgatttttgccatcagccttt
gcgcctttgttggacgaaggccacgtcatcggggagcccaagcccctgtttgagaaaatt
gaccctgatatggccaaggagtggcgctctcgctacggtggacgtcaagccaaggcaccc
gaagcgcccaaggtggagttgctacccacggatcgcaaacgtaagacttggtcggacaga
tgcggcaataggttttggcatccaatctcatttgattcactgctgcgatga

DBGET integrated database retrieval system