KEGG   Monosiga brevicollis: MONBRDRAFT_16143Help
Entry
MONBRDRAFT_16143  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
mbr  Monosiga brevicollis
Brite
KEGG Orthology (KO) [BR:mbr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MONBRDRAFT_16143
Enzymes [BR:mbr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     MONBRDRAFT_16143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1 DUF2680
Motif
Other DBs
NCBI-GeneID: 5889849
NCBI-ProteinID: XP_001744757
JGI: 16143
UniProt: A9UW49
AA seq 622 aa AA seqDB search
MTPREPGSSFFNSNDDDFVAKMKEAEAQIVIFYGSQTGTAEDFAMRLAGEAKRYGIKALV
IDPQDADMTQLSELSTIENAVALFCLATYGEGEPTDNAQAFHDLLEEKTEEENDWLENVN
YAVFGLGNKTYEHFNAMATFVDDKLKAGGGRRLIDVGMGDDDVNLEEDFLEWKDLLWSAV
CELMGKDANAISASFRTYQLVPVDERKKVFTGEPAIANSFKHQRPPYSQKNPFLAPIRVR
RELYKDEGRSCLHIELDISGSGIRYTAGDHAAVYPTNNASLVQAVAERLQVPLDDIFQLQ
AVDTFTRKSTPFPCPCTYRTALSHYVELTHTPSLNIIAEMVQYAKDEQQKERLAFLCSKQ
GRSEYNKHIHNRHLTILDVLAEFSSVEMPIDHLLELLPRMQPRYYSISSSSKTNPDRIHM
TVAIVTYKNGADTTVEGVATTWFCRLALDTDRVPMFVRRSTFRLPRKPKVPMIMIGPGTG
VAPFRGFIQERLFLMQDSEEQFGETHLFFGCQNESKHFMYRDEFEDAVMKKALSGLHTAF
SRDQATKVYVQHRLRERKEDVWRVLQAGGHLYICGDAKYMAQDVRKAIIEILVEMGDKTQ
QQALQFLKTMEEKHRFQQDVWS
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgcgcgaacctggcagcagcttcttcaacagcaatgatgacgactttgtcgcc
aagatgaaggaagccgaagctcaaatcgtcatcttctatggctcccagactggtaccgca
gaagactttgccatgcgtcttgctggcgaagcgaagcgctatggtatcaaggctctagtc
attgacccccaggatgcggacatgacgcagctctccgagctcagtaccatcgaaaacgct
gttgccctcttctgcctggccacgtacggtgaaggcgagcccaccgacaacgcccaagcc
ttccacgacctcctggaagagaagacggaggaggagaacgactggctcgagaatgtcaac
tacgccgtctttggccttggcaacaagacctacgagcacttcaacgccatggccaccttt
gtggacgacaagctcaaggccggtggtggccgccgtctcattgatgtgggcatgggtgat
gacgacgtgaacctggaagaggattttctggaatggaaggacttgctctggtccgccgtc
tgcgagctcatgggcaaggatgccaacgccatcagcgcctccttccgcacgtatcagctg
gtgcccgtggacgagcgcaagaaggtgttcaccggtgaacctgccattgccaactcgttc
aaacatcagcgcccgccatacagccagaagaacccctttctggccccaatccgtgtgcgc
cgcgagctgtacaaggatgaagggcgcagctgcttgcacattgagctcgacatctctggc
tcgggcattcgctacactgccggtgaccacgcagccgtctaccccaccaacaacgcttcc
ctggtccaggctgtcgccgagcgcttgcaagttccccttgatgacattttccagctgcaa
gccgtcgataccttcacccgcaagagcacccccttcccctgcccgtgcacgtatcgcaca
gccctgagccactacgtcgagctgacacacaccccctctctcaatatcattgctgagatg
gtgcagtacgccaaggatgaacagcagaaggagcgcctcgcctttctttgcagcaagcaa
ggccgcagcgaatacaacaagcacattcataaccgtcacctcaccatcctcgacgtcctg
gccgagttctcgtccgtggagatgcccatcgaccatctgctggagttgttgccgcgcatg
cagccccgctactactcgatcagcagcagcagcaaaaccaaccccgaccggatacacatg
acggtggccatcgtcacctacaagaacggtgcggatacgacggttgagggtgtggccacc
acctggttctgtcgcttggcgctggacaccgatcgtgtccccatgtttgttcgccgctcc
actttccgcctgccacgcaagcccaaggtacccatgatcatgatcggcccgggcaccggc
gttgccccctttcgtggctttatccaggaacgtttgttcctcatgcaagattcagaagag
cagtttggcgaaacacacctcttctttggttgtcaaaacgagagcaagcatttcatgtac
cgcgacgagtttgaggatgccgtgatgaaaaaggcgctgagcggcttgcatacggctttc
tcccgcgatcaggccaccaaggtgtatgtgcagcaccgcctgcgtgagcgcaaggaagat
gtatggcgtgttcttcaagcaggaggccacctgtacatttgcggtgatgccaaatacatg
gcgcaagatgtccgcaaggccattattgagattctggtcgagatgggcgacaagacacag
caacaagccttgcagtttctcaagaccatggaagagaagcatcgctttcagcaagacgtt
tggtcataa

DBGET integrated database retrieval system