KEGG   Monosiga brevicollis: MONBRDRAFT_16401Help
Entry
MONBRDRAFT_16401  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00020  Citrate cycle (TCA cycle)
mbr00640  Propanoate metabolism
mbr01100  Metabolic pathways
mbr01110  Biosynthesis of secondary metabolites
mbr01130  Biosynthesis of antibiotics
mbr01200  Carbon metabolism
Module
mbr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MONBRDRAFT_16401
   00640 Propanoate metabolism
    MONBRDRAFT_16401
Enzymes [BR:mbr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     MONBRDRAFT_16401
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MONBRDRAFT_16401
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 5890146
NCBI-ProteinID: XP_001744918
JGI: 16401
UniProt: A9UX44
AA seq 315 aa AA seqDB search
MASPALLVRTVRTIYDATRPALRINKDTKVICQGFTGKQGTFHSEAAIAYGTQMVGGVSP
GKGGREHLDLPVFNSVKEAKDATNADATVIYVPPPFAAAAIFEAMEAEIPLAVCITEGIP
QADMVRVKHALVRQDKTRLIGPNCPGIIKPGECKIGIMPGHIHVPGNIGIVSRSGTLTYE
AVGQTSAVGLGQSLCVGIGGDPFNGTNFIDCLEVFLNDPETKGIIMIGEIGGSAEEEAAE
YLKQHNTVRPVVSFIAGLTAPPGRRMGHAGAIISGGKGGAGAKIAALEDAGVIVSKSPAQ
MGVLMKQEMEKAGLA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggcctctcccgctctgctagtgcgcaccgtccgcaccatctacgatgcgactcgcccc
gctctccgtatcaacaaggacaccaaggtcatctgccagggcttcactggcaagcagggt
accttccacagcgaagctgccattgcttacggcactcagatggtcggtggtgtctctccc
ggcaagggcggacgtgagcaccttgatctgcctgtcttcaacagcgtgaaggaggccaag
gacgccaccaatgctgatgccactgtcatctatgttcctcctccttttgctgctgccgcc
atcttcgaggccatggaggcggaaattcctcttgccgtttgcatcaccgagggcattcct
caagctgacatggttcgcgtcaagcacgcactggtccgccaagacaagactcgccttatt
ggccccaactgccccggcatcatcaagcccggcgagtgcaagattggcatcatgcccggc
cacattcacgtgcccggcaacattggcattgtctcccgctcgggaaccctcacttatgag
gctgttggccagacttccgccgtcggcttgggccagtccctctgcgttggcattggtggt
gatcccttcaacggcaccaactttattgattgcctcgaggtcttcctcaacgaccctgag
accaagggtatcatcatgattggcgagattggtggctctgctgaagaggaggccgccgag
tacctcaagcagcacaacactgtacgtcccgtcgtttccttcattgctggtctgaccgcg
cccccaggccgccgcatgggccatgctggtgccattatttccggtggcaagggcggtgct
ggcgccaagattgctgcgctcgaggatgccggcgtcatcgtctccaagtctcccgcgcag
atgggcgtgctcatgaagcaggagatggagaaggccggccttgcttaa

DBGET integrated database retrieval system