KEGG   Monosiga brevicollis: MONBRDRAFT_18132Help
Entry
MONBRDRAFT_18132  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00062  Fatty acid elongation
mbr00071  Fatty acid degradation
mbr00280  Valine, leucine and isoleucine degradation
mbr00310  Lysine degradation
mbr00380  Tryptophan metabolism
mbr00410  beta-Alanine metabolism
mbr00640  Propanoate metabolism
mbr00650  Butanoate metabolism
mbr01100  Metabolic pathways
mbr01110  Biosynthesis of secondary metabolites
mbr01130  Biosynthesis of antibiotics
mbr01200  Carbon metabolism
mbr01212  Fatty acid metabolism
Module
mbr_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
mbr_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
mbr_M00085  Fatty acid biosynthesis, elongation, mitochondria
mbr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MONBRDRAFT_18132
   00650 Butanoate metabolism
    MONBRDRAFT_18132
  Lipid metabolism
   00062 Fatty acid elongation
    MONBRDRAFT_18132
   00071 Fatty acid degradation
    MONBRDRAFT_18132
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MONBRDRAFT_18132
   00310 Lysine degradation
    MONBRDRAFT_18132
   00380 Tryptophan metabolism
    MONBRDRAFT_18132
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MONBRDRAFT_18132
Enzymes [BR:mbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MONBRDRAFT_18132
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 PEPCK_C
Motif
Other DBs
NCBI-GeneID: 5888957
NCBI-ProteinID: XP_001743796
JGI: 18132
UniProt: A9UU77
AA seq 287 aa AA seqDB search
MAASLVRMCRGVAAPLMVTRRLMSASAGTFNNILVERTGSNNQVGVITLHRPKALNALCD
DLMTEMNTVLDDFEANSDVRTIVITGHGKSFAAGADIKEMADRDFIGVYSGNFLSHWDRV
TRCTKPVIAAVNGFAFGGGCELAMMCDIIYASSSAKFGQPEIKLGTIPGAGGTQRLTRAI
GKSKAMELVLTGDHISASEAERIGLVSKVFEGDQLLPETIKLAERIGAFSQPVLQMAKEA
VNKSQELSLAEGLHLEKRLFHSSFATADRREGMKAFAERRAAEFKDE
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctctctggttcgcatgtgccgcggcgttgccgcgcccttgatggtgactcgt
cgtttgatgagcgccagcgcaggcaccttcaacaacatcctggtcgagcgcacgggctcg
aacaaccaggtcggcgtcatcaccctccatcgccccaaagccctgaatgcgctgtgcgat
gacctcatgaccgaaatgaacacggttctggacgactttgaggccaacagtgacgtgcgc
accattgtcatcactggccatggcaaatcttttgcagcgggcgccgacatcaaggagatg
gccgatcgcgacttcatcggcgtttactcgggcaacttcctctcccactgggaccgtgtc
acgcgctgcaccaagcctgtcattgctgctgtcaatggctttgcatttggtggtggttgt
gagctggccatgatgtgcgacatcatctatgccagcagctcggccaagtttggccagccc
gaaatcaagcttggcaccattcccggtgcgggcggcacgcagcgcttgacgcgcgccatt
ggcaagtccaaggccatggaactcgtgctcacaggtgaccacatttccgccagtgaagcc
gagcgcatcggcctggtcagcaaagtgtttgagggggaccaactactgcctgagaccatc
aagttggcagagcgcatcggtgccttttcccagcccgtgctgcagatggccaaggaagcc
gtcaacaagtcgcaagagctgagcctcgctgagggcttgcacctggagaagcgtctcttc
cactcctcctttgccacggccgatcgccgcgagggcatgaaggcctttgccgagcgtcgg
gccgccgagtttaaggacgagtag

DBGET integrated database retrieval system