KEGG   Monosiga brevicollis: MONBRDRAFT_18722Help
Entry
MONBRDRAFT_18722  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
Organism
mbr  Monosiga brevicollis
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 MMR_HSR1 AAA_7 RsgA_GTPase TrwB_AAD_bind AAA_22 AAA_29 T2SSE Dynamin_N
Motif
Other DBs
NCBI-GeneID: 5890145
NCBI-ProteinID: XP_001745094
JGI: 18722
UniProt: A9UX43
AA seq 1269 aa AA seqDB search
MPDENAHVLANRLKSEWRRQKAKGHDKASLTLALTRAFWAMFAVGGIFKFLQDTLSFVSP
QLLKYLIRYVNESQFGEAQPVWHGYALAVGMFITAIFQSIFLHQYFHRVMKTGMRLRSAI
INVVYEKSLHLSNTARQQSTTGEIVNLMSVDAQRFMDLMGYLQMIWSAPFQIALSLYFLW
QLMGPSTLAGLGVMILMIPLNGVLAKVTRDLQKKIMKEKDDRIKHMHEILNGIKILKMYA
WERPFAGFIQDIRNRELKILTKFAYLNAVSSFSWTAAPFLVSLVTFIAYTLSGNTLTAEK
AFVSLSLFNILRFPMAMLPMMITSLVEATVSVNRLRTFLLHEETDPSNVIRDRMALALPA
AVMERGEFSWNKTDVALRNIDLVLHQQEICMVVGRVGSGKSSLCSALLGDMYKHAGRVVL
PGKVAYVPQSAWIRNATVRENILFGKAFDAKRYKQVIHACALEPDLLILPGGDACEIGDR
GVNLSGGQKARVSLARAVYQDCDVYVLDDPLSAVDTHVASHIFKLVLGPEGMLRNKARLL
VTNALQFMREAQNIVVMNKGEIKEQGTFRELCDHEGDFKKLMTDFTTGGTGDKPTGSKDA
GGDVKELGSESTEIESTTDEQRTSSSKSNVILDSTGTKGSDSALMPVNDKTDKAEKSGAA
GESATEHSGLIKKEKAQEGNVKLDVYMSYFRAITWPVTISLLAMYVVSYGMQVGSNKWLD
VWSSEQDKHDHAVSSNATQVPNVRPVGVYLGVYAALGMGNALGVLFTTLVLAYGSIRASR
VMHNDMLLRIVRCPMSFFDTTPLGRIVNRFSKDIYVLDETIPRSLRSFMSTFMQVVATIV
VISVSTPLFMVIILPMSLLYYYVQRYYVATSRQLQRLESVSRSPIYAHFTETLHGVSNIR
AYGKVPDFVQENEERVDFNLQAYYPFICANRWLALRLEFLGNSIIFFAALFAVIEVEEKS
SAISPGTAGLSLSYAMSVTQTLNWMVRMSSQLETDIVAIERVEEYCSVPVEAPPILDHRP
KPNWPDQGNISFDHYCVRYREGLDLVLREISCTIEGGQKIGCVGRTGAGKSSMTLSLLRI
LEAAGGRIVIDGENIAKIGLEDLRSRLTIMPQDPIVFSGTIRQNLDPFKRHTDDELWRAL
RTCHLGDKVTEMEGALDHVVSEGGGNFSLGERQLLCLSRAVLRKTKVLILDEATAAVDVE
TDELIQETIRSEFAECTIFTIAHRLNTIMDSDKIMVLDKGKVIEFDSPAALLATRTSVFY
GMAESANLI
NT seq 3810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacgagaacgcccacgtcctggccaatcgcctcaaatccgaatggcgccggcaa
aaggccaagggccacgacaaggcctccctcactctggccttgacccgggctttttgggcc
atgtttgccgtcggtggcatcttcaagttcttacaggacaccctttcctttgtctcgcca
cagctcctcaaatacctcattcgctacgtcaacgagtcacaatttggcgaggctcaaccc
gtgtggcacggctacgcccttgccgtgggcatgttcatcaccgccatcttccaaagcatc
tttcttcaccagtactttcatcgcgtcatgaagacaggcatgcgtctacgctctgccatc
atcaatgtcgtttatgaaaagtcactccatctcagcaacacggctcgccagcagagcacc
accggcgaaattgtcaacctcatgtccgtggatgcccagcgtttcatggatctcatgggc
tacctgcagatgatttggtccgcccccttccagattgctctctccctctactttctctgg
cagctcatgggcccctctaccctggccggtctgggcgtcatgatcctcatgatcccgctc
aacggcgtgctcgccaaggtgactcgcgatttgcaaaagaaaattatgaaggagaaggac
gaccgcatcaaacacatgcacgaaattctcaatggtatcaagatcctcaaaatgtacgcc
tgggagcggccctttgccggctttattcaggacattcgcaaccgtgagctgaagatcctg
accaagtttgcttacctcaacgccgtcagctccttcagctggaccgcggctcccttcctc
gtatctctggtcacctttatcgcctacacgctcagtgggaacacgctcactgccgaaaag
gctttcgtgtccctctccctcttcaacatcctccgatttcccatggccatgcttcccatg
atgatcacctcccttgtggaagccaccgtctccgtgaaccgcctccgtaccttcctcctc
catgaggaaaccgatcccagcaacgtcatccgtgatcgaatggccttggccctgcccgca
gctgtgatggagcgcggcgaattctcatggaataaaaccgatgtggctctgcgaaacatt
gacctcgtcctgcaccagcaggagatctgcatggtcgtcgggcgcgtgggatcgggcaag
tccagcctatgctccgctcttcttggcgacatgtacaagcacgcgggtcgcgtcgtcttg
cctggtaaagtggcctacgtgccacaatcggcttggatccgcaacgccaccgtgcgcgag
aatattctctttggaaaagcctttgatgccaagcgttataaacaagtcattcacgcttgc
gctctcgagccggatctcctcattctgccaggtggcgatgcttgcgagattggcgatcgt
ggcgtgaatctctctggcggccaaaaggcccgtgtgagtctggctcgagccgtgtaccag
gactgcgacgtgtacgttctagatgaccctctctcggcggtggacacccacgtggcttca
cacatctttaaactcgtccttggccccgagggcatgctgcgcaacaaagctcgtctcctc
gtcaccaacgccctgcagtttatgcgtgaggcgcaaaacattgttgtgatgaacaaaggt
gaaatcaaagagcagggcacatttcgcgagctatgcgatcacgagggcgactttaagaag
ctcatgaccgatttcacgacgggcggcactggcgacaaacccacgggatccaaggatgcg
ggtggggacgtgaaggagctaggttccgagtcaactgagattgaaagcaccacggacgag
cagcgcacttcctcaagcaagtcgaacgtgatcctcgactcaacgggcacaaagggctca
gactctgcgctcatgcctgtgaacgataaaacggacaaggctgaaaagtcgggagctgct
ggcgaatcagccaccgaacattcgggtctgatcaagaaggagaaggcgcaggaaggcaat
gtcaagctcgatgtgtacatgtcttacttccgcgccattacttggcccgtcaccatctcc
cttctggccatgtacgttgtctcgtacggtatgcaagttggctccaacaagtggcttgat
gtgtggagctcggaacaggacaagcacgaccacgccgtttcctccaatgcaactcaggtc
cccaacgtccgccctgtgggtgtctatctgggcgtttacgctgccttgggtatgggcaac
gcgcttggcgttctcttcaccacgctcgtcctggcctacggctcaatccgcgcgagccgt
gtcatgcacaacgacatgctgctgcgcatcgtgcgctgtcccatgtcattctttgacaca
acaccgctcgggcgcattgtgaatcgcttttccaaggacatttatgtccttgacgaaacc
attccgcgctccctgcgttcgttcatgtccacctttatgcaggtcgtggccaccatcgtc
gtcatcagtgtatccacgccgctcttcatggtcatcatcttgcccatgtccctgctgtac
tactacgtgcagcgttactacgttgccacctcccgtcagttgcagcggcttgaatcggtg
agtcgcagcccaatctacgcgcactttacggagacgttgcacggtgtaagcaacatccgt
gcctacggcaaggtaccagactttgttcaggagaacgaggagcgtgttgacttcaacctg
caagcgtactacccctttatctgtgccaaccgctggttggcgctgcggcttgaatttctg
ggtaactcgatcatcttttttgcggcactgtttgccgtgatcgaggtggaggagaagagc
tcggcaatcagtcccggcacggctggtctatcgctctcctatgccatgtcagtgacgcaa
acgctcaactggatggtgcgcatgtcaagccagctggagacggatattgtcgccattgag
cgtgtggaggagtactgctcggtgcccgttgaagcgcctccaattttggaccatcgaccc
aaacccaactggcctgatcaaggcaatatcagctttgatcactactgcgtgcgctaccgt
gagggacttgaccttgtgctgcgcgagatctcctgcaccattgagggtgggcaaaagatt
ggttgtgtgggtcgcacgggtgcaggcaaatcgtccatgacactgtcactcctgcgcatt
cttgaagctgctggcggccgcattgtaatcgatggcgagaacattgccaagattggcctt
gaggacctacgctcgcgcctgaccatcatgccccaggacccgattgtcttctcgggcacc
attcgtcagaaccttgatccctttaaacgacacacggacgatgaattgtggcgagcgctg
cgcacttgtcacttgggtgataaagtgactgagatggaaggcgcgttggatcacgtcgtg
tctgaaggaggtggcaacttctcactgggtgaacgtcagctcctgtgcttgagtcgcgcg
gtgctgcgcaagaccaaggtgttgattctcgacgaagcaactgccgccgtcgacgtggag
acggatgaactcatccaagagacaatccgcagcgagtttgctgaatgcaccatcttcacc
attgctcatcgcctgaataccatcatggacagtgataagatcatggtcttggacaagggc
aaggtcattgagtttgactcgcccgcggctcttctggccacgcggacatctgtcttctat
ggcatggcagaatcggcaaaccttatctag

DBGET integrated database retrieval system