KEGG   Monosiga brevicollis: MONBRDRAFT_20211
Entry
MONBRDRAFT_20211  CDS       T01042                                 
Name
(RefSeq) hypothetical protein
  KO
K10408  dynein axonemal heavy chain
Organism
mbr  Monosiga brevicollis
Brite
KEGG Orthology (KO) [BR:mbr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mbr03037]
    MONBRDRAFT_20211
   04812 Cytoskeleton proteins [BR:mbr04812]
    MONBRDRAFT_20211
Cilium and associated proteins [BR:mbr03037]
 Motile cilia and associated proteins
  Dynein arm
   MONBRDRAFT_20211
Cytoskeleton proteins [BR:mbr04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     MONBRDRAFT_20211
SSDB
Motif
Pfam: AAA_6 DHC_N2 DHC_N1 AAA_8 Dynein_C AAA_9 AAA_7 MT Dynein_heavy AAA_lid_11 AAA_5 Dynein_AAA_lid AAA_lid_1 AAA_22 AAA AAA_18 bpMoxR AAA_16 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 5889351
NCBI-ProteinID: XP_001744294
JGI: 20211
UniProt: A9UUZ7
AA seq 4276 aa
MSDIYAPLLTTGGSWPDSVRNEFSAGLNRFMSALTEASNRSAGKTVLYIPNEELSDAAIQ
DRDLLQRLDSTVIQWTRLLRQVLSSTSVEGVAAIDMPLDEIAYWRQRQADMSGIHAQLDQ
PKAQRILSLLKAANSSYVSQFESWASKIAEGMSVSESNFKFLSVLADPCTRLNTLGLNAI
PERLPELVDLVRMIWLHSQHYNSREQITSLFQKLSNAIISRCCECIAHFARRQGAGTRPP
PLLAGTRGPELSRSLEQLEANFAASLQQLRQVQDLVFDVKSNKFQHEFVQFKASLKELEV
LMQGIIGTAFETATSVEQGVELLTIFAPLRARETLRRALNRHTDSVFKRFNDELEHVKQV
FSKQRDAPPVGPTMPKYAGACMWALALRTNIDQSQQLLTSRQLHATSDAGHRGDEATFSN
EVLHSHSLLSNALADFANKTHAAWVAQLGTDLKALLEISLMKRRPDRRLALNFDPSLERL
FREIQYFDKLGMSIPAPARDIFHRSEELRCLRDMTMLVVRDYNRIYDLLADDEQQLFSRR
IQLLDNKVHNGLTKLTWDKAKFIKEYVNTVRANAATVRKQVDNYLASKAYVRALCDTAAQ
RSLFVYDAKTMYEPTEFAQQQERYVARVLSRLGTIHQKIVAALRATYKDFSGDPSAVQSA
WKLYVAGIDERLQNALVTVARRSLSELNRALHGDGKTLNAPLFKVGVLLDDASSSLLLQP
SFDFTYRLVNTVADRIMAGLVVIPRLLAAVSQREVKDLPSYEAAARADRDVRVLLDRIAR
DMDKCRPEAEAFAQGWRDRYYEIWATDKARFIERYIEMQPSLAKFDGDIARYGEVSHNVQ
KEETFVILQFLHLDTSLLKFALLDHCKEWQTRLSQVLHDQTVQELADLHAYLEEQARLLR
QRPEGLDAVIASVALYDEARKRRESTQQRFAPLKERFEILHKYDVSISAQVEQSHLNLAA
AWTSFNDALREGAALIEEAKSECKSGLLASLDELARNAAGLRSQFLEDGPTSGSLTPEQA
LKAIDTFKAKVETTRQAEQALKNGLQVFDITQEPFQEILDTVKDLGHLEQLWRLAEEWDN
NFISWRDTQFADIVTDDLAQTATSFNKRLLKMLREVKDKDWEMTAAYRNKIDQFRRTMPL
IEDLKNPALRERHWSRLQGHVGENFSHTSEEFTLGRMIELGFDRFNEEVGDISRAASKEL
SIEQTLAGITEVWATVELEAAAHKERGHFILKGTDDIYQLLEDDQIKLATMKASPFVKAF
EADVDRWEKTLGTVLEVVDMLLTVQRQWIYLENIFLGEDIRQQLPEETKQFDLMDAQFKD
IGVHLHKDCHACRATHRDGLLAQLVAMNGVLEQIQKSLDEYLETKRQAFPRFYFVSNDDL
LEILGQSKNPPAVQPHLLKCFDNVKSLELHNAVGRSQVQALGMTSADAEYVPFKTAVALD
GPVEVWLTSVETEMRHTLKQLLQECMVAHRKQKRDKWLKEWPGQLVLTVSQMAWTSECFK
AISDKKHGAKAGLKAIKKKQVSLLNKLTEAVRAVKNKTQRKKLVALITIEVHSRDVIDRL
LKVANIDQNAFEWLMQLRFYWEKPETGPSEGECIIRQTNTHFSYGYEYSGNSGRLVITPL
TDRCYMTLTTALHLKRGGSPKGPAGTGKTETVKDLGKSLGDYVIVINCSDGMDYKSLGVM
FRGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSAQIPLSPENPKTRFTFEGMDINLL
WSCGIFITMNPGYAGRTELPDNLKSMFRPISMMKPDTQLIAEIILFGQGFNNTRVLAKKA
DTLYKLAAQQLSKQDHYDYGLRAMVSTLLYAGRKREAMPEMPHEEVLLLAMKDMNVAKMT
GADLPLLQHMMSDLFPGVETMEVEYGAFREAIKADLVKQGYQATPWMITKAIQLFETKNS
RHSVMIVGRTGSGKSVAWHTLQRAMTQCARDNVEGFVPVREYPLNPKALSLAELYGEFNI
ATNEWTDGVLSSVMRNVCSDEKPDQKWIVFDGPVDTLWIESMNSVMDDNKILTLINGDRI
SMPAQVSLLFEVEDLAVASPATVSRCGMVYHDTADLGWQPYVTSWLSNPRFEAYRGPLQA
LFEKYVERLLDFVRHKCEELVETSLLSRVTSLCNLLDAFLVPENGIDPADKAHFARLLEQ
WFLFACVWSLCAGVNEAGRKLVDNFIREIEGQFPAKDTVYEYFVDVKNHTWAHWEKELSA
GWKYAPDASYHSIQVPTVDTVRYEFLLSNLIAHQRPTLMVGPVGTGKTSVVELVMAKLDA
AQFNRLTINMSSQTSSNNVQEIIEGQVEKRTKGVFVPLGGKQLLTFLDDLNMPAKDTFGS
QPPLELLRQLMEYGFMYDRQKQVLKHIKDMRVVAAMGPPGGGRSVISRRLQSRFNVINMT
FPSRSQIQRIFGTMINQKLQDFDEACKPVGDMVTNGTIDVYEYMSTRMLPTPAKIHYLFN
LRDISKVFQGLLRAHKDVHDTTDALSRLWVHECFRVFCDRLISSSDVAEFTKLIEDKLHE
LFNISYSTLCPNRVVPVFADFLKAEDNPVYEDVRDPQVLRRVLQERLDEYNESGFVPMDL
VLFRDAIEHVCRVVRVVRCERGNMLLIGVGGSGRQSLTRLASYVLEFKVFQIEVTRQYRI
NEFREDLKTLYRQAGLENKPTVFLFTDTQIVIEDFLEDINNILSSGEVPNLFAPDELEEI
RNELAPLARKQGLDESPVGLYKYFISRVRNNLRVVLCMSPVGEAFRNRLRMYPGLVNCTT
IDYFHAWPEDALLAVAHRYMHDVDFGTGEDGEAVRKAVSSTFAVIQQSVLSSSAQMLEEL
KRHNYVTPTNYLELVMGYKQLLAEKRRELGDAADKLANGLGKIDETSAKVEQMSIELVET
KKQVAEFQRECEEYLVIIVQQKREADDQQMAVSQRSEKISVEAKQCQKLASDAQADLDEA
LPALESAMEALNSLNKGDITEIKSYSKPPDLVAMVMEAVMVLRKSKPDWAEAKRQLGDTN
FINQLIEFDKDNMSEKTLKKVRTYVVRPEFDPDVVGRVSNAARSLCMWVRAMDVYGRIFK
VVEPKRQALQAAQTALKAKEDSLAEAEAKLREVTEKVAKLQSDYESKLQTKEELRIKSEQ
TEIKLERAAKLVSGLAGERSRWEQSVGELRRGIKFLVGDCLMCAGFLSYLGPFISEYRAR
IVEQWRRHIRDNNIPSDPDFSMTTLLAKATDVRFWNIQGLPSDQFSTENGVIVTRGRRWP
LMIDPQGQAIKWIKNMERDRKLQVVDMQQPDYIRTLENAIQFGTPVLMQNVGEELDPSLA
PVLNKAFTKVGGRLMLKLGDKEIEYNPDFRFYLTTKMSNPHYTPEISTKTTIVNFAVVQQ
GLEAQLLGIVVSKERPELEKQKNELVLNIAAGKKKLVDLEDKILQLLSSAKGSLLDDEEL
VNTLNTSKVTSVEVSEQLVVAEATEKEIDAAREGYRPSASRASVLFFVLDDVSKIDPMYQ
FSLDAYINLYTLSIDNSAKAPALDQRIESINEYHNYAVYRYTCRGLFEKHKLLFALHMNA
KILESQNKIALGEYNFFLRGGQVLDRDAQVPNPAPGWITSEAWDNVTEMERLLPKFAGLT
ASFEQQLRDWQAWYVHPEPETAPLPGEWQATCNELQRMCIVRALRPDRVAIVAIQYIVNN
LGQRFVEPPPLDMNAVLADSNAMTPLIFVLSVGVDPTKQLLDLAERSGMSDRFHSLSLGQ
GQAPIAERLIAEGASRGDWVFLANCHLSLSWMPSLSKLVELLESQQPHPDFRLWLSSKPD
PRFPISILQAGIKMTTEPPNGIKANMKRLYNTISEEQFERCNASSKYKKLMFSLTFFHSI
LLERRKFQMLGWNVQYPFNDSDFEVSENLLALFLDEYEETPWESLKYLIAGINYGGHVTD
DWDRRLLLTYINELFSDQVLQVEACPVSASPLYFVPPDGPLQSYKDYINTLPGVDPPTAF
GQNANADISSMIREARTLLGTLVSMQPAVSAKEGGSREDKVLELARDMLARLPKTIDYEA
TAKLLAADPRPLNIVLLQEIQRYNRLLEAMRVNLVDLDHGIQGLVVMSHELEQIFECIYQ
GEVPVAWKATYPSQKPLASWMRDLVERIEFLTQWAVTGRQPLIFWMSAFSFPTGFLTAVL
QQAARSNGVSIDTLSWEFSVMTVDDVNIVEEPRDGVYVRGLFLEGAGWDKRNACLVEAEA
MQLVSSMPTIHFKPVENKKVAKKGSYACPCYYYPNRTGEGGASAWSFVISVDLKTGDLPP
EHWVKRGTALLMSLDS
NT seq 12831 nt   +upstreamnt  +downstreamnt
atgagtgacatttatgcaccactccttaccaccggtggctcctggcccgattctgtgcgc
aatgaattttctgctggcctcaaccgcttcatgtctgcgctcaccgaagccagcaatcgc
tctgccggaaaaaccgtgctctacatccccaatgaagagctgtctgatgctgccatccaa
gaccgagacctccttcagcgtcttgattcaaccgtcattcaatggactcgcctcctgcga
caggtgctcagcagcacgagcgtcgagggcgtggccgccatcgacatgcccctcgacgaa
attgcctactggcgccagcgccaagcagacatgagcggcattcacgctcaactcgatcaa
ccaaaagctcaacgtattttgtctctgctcaaggctgccaactcttcctacgtctcccaa
tttgagtcctgggcctctaagattgctgagggcatgagcgtgtcggaaagcaatttcaag
tttctctccgtgctggctgatccttgcactcgtctcaacacgctgggtctcaatgcgatc
ccggagcgcctgcctgagttggtcgacctcgtgcgcatgatctggctgcactctcagcat
tacaactcgcgcgagcaaatcaccagtctcttccagaagctgagcaacgccatcatttcg
cgctgttgtgaatgcattgctcactttgctcggcgtcagggcgctggtactcgaccaccc
ccacttctggctggcacccgaggtccggagctcagccgcagcctcgagcagctcgaggcc
aactttgccgcgagcctacaacaactgcgacaggttcaggatctcgtattcgatgtcaag
tccaacaagtttcagcacgagtttgtccagttcaaggcctcgctgaaggagctggaagtg
ctcatgcagggcatcatcggcactgcatttgagacagccacctcagtggagcagggtgtc
gagctcctgaccatctttgcacctttgcgagctcgagagacgctgcgccgagcgctgaac
cgccacacggacagcgtttttaagcgtttcaacgacgagctcgagcatgtcaagcaagtc
ttctccaagcagcgcgacgcgcctccagtaggacccacgatgcccaagtatgctggtgct
tgcatgtgggcgctggcgctgcgcaccaacatcgatcaatctcagcaactgctgacttcg
cgtcagctgcatgccacgtccgatgcgggccaccgcggtgacgaggcgacctttagcaac
gaagtgctgcatagccattcattgctcagcaatgcacttgcagactttgccaacaagacc
catgccgcttgggtcgcgcaactaggcaccgacctcaaggcactgctggaaatcagtctc
atgaagcgccgccctgatcgtcgactcgccctcaactttgatccttccctcgagcgtctc
tttcgcgagatccagtactttgacaagttgggcatgagcattccagcaccggcgcgggat
attttccatcgatcggaggagctgcgctgtctacgtgacatgaccatgctggtggtgcga
gactacaaccgcatctacgatcttttggcggacgacgagcagcagcttttcagccgacgc
attcagctgcttgacaacaaggtgcacaacggcttgacaaagttaacttgggacaaggcc
aagttcatcaaggagtacgtgaacacggtgcgcgccaatgctgcgaccgtgcgcaagcaa
gttgacaactacctcgcttctaaggcctacgtgcgcgctttgtgcgacacggccgctcag
cgatctcttttcgtctacgatgccaagaccatgtacgagcccacggagtttgcgcaacaa
caggagcgctacgtggcacgcgttctcagccgactgggcaccattcaccaaaagatcgtg
gcagccttgcgggctacttacaaggattttagtggtgaccccagcgccgtgcaatcggcc
tggaagctgtacgtggccggcattgatgagcggcttcaaaatgctctggtgaccgtggcg
cgtcgctctctcagcgagcttaatcgagctttgcatggtgacggcaagacgctcaatgcg
cctcttttcaaggtcggcgtccttttggatgatgcatcttcttcgctccttctccagccg
agcttcgatttcacctatcgcttggtcaacaccgttgccgatcgcatcatggctggtctc
gtggtcatcccgcggctgttggcggccgtgagccagcgtgaggtcaaggatctgccatcc
tacgaggctgctgcccgcgccgaccgcgatgttcgcgtgctcttggaccgtattgcgcgg
gatatggacaagtgccgcccagaggccgaggcctttgcgcagggctggcgtgaccgttat
tacgaaatctgggctaccgataaagcacgcttcattgagcgatacatcgagatgcagcct
tccctggccaagtttgatggcgacattgcccggtatggggaggtctctcacaacgtgcag
aaggaggagactttcgttatcctacagtttctgcacctggacacgtcgttgctcaagttt
gctctcttggaccattgcaaggaatggcagacccgattgagccaggttctacatgatcaa
acggtgcaggagttggctgatctgcacgcctatctcgaggaacaggcccgcttgctgcgc
cagcgccccgagggcctcgatgccgtcattgcgtccgtcgccctgtacgacgaggctcgt
aagcgccgtgagtcaactcaacagcgctttgctccactcaaggagcgatttgagattctt
cacaagtatgatgtcagcataagtgctcaggtggagcagtctcacctcaacctggctgcc
gcctggacctcgttcaacgacgccctccgcgagggcgctgctctcatcgaggaggccaaa
tccgaatgcaagtcaggcctcttggcatccttggacgagctcgcgcgcaacgctgccggg
ttgcgctcccagttcctcgaggatggcccgacctcgggatccctcacacccgaacaggcc
ctcaaggccattgataccttcaaggccaaggtggagacgacgcgccaggcggagcaagcc
ttgaagaatggcctgcaagtctttgacatcactcaagagccatttcaggagatcttggac
acggtcaaagatttgggccaccttgagcagctctggcgtctggcggaggagtgggacaac
aatttcatctcttggcgagacacacagtttgctgacattgttacggacgatctcgcgcaa
actgcgaccagcttcaacaaacggcttctcaaaatgttgcgtgaggttaaggacaaggac
tgggaaatgaccgccgcctatcgcaacaaaatcgatcaattccgacgcaccatgcctctc
attgaggatctgaagaatccagcgctccgtgagcgccactggagccgccttcaaggccac
gtcggcgagaacttcagccatacgtcagaagagtttacccttggccgcatgatcgagctc
ggctttgaccgcttcaacgaagaagtgggcgacatctcgcgggctgctagcaaggaactg
agcatcgagcaaacattggccggcatcaccgaggtgtgggccacggttgagctcgaggca
gcggcccacaaggaacgtggccacttcattctcaagggaacggacgacatttaccagctg
ctcgaagatgatcagatcaagttggccaccatgaaggccagtccttttgtcaaggcgttt
gaggcagacgtggaccgctgggagaagaccttgggaacggttttggaggtggtggacatg
ttgctgaccgtgcagcgtcagtggatctacttggagaacatcttccttggcgaggacatt
cggcagcaactgcccgaagaaaccaagcaatttgacctcatggatgcccagtttaaggat
attggtgtgcacctgcacaaggactgccacgcttgtcgcgcgacccaccgcgacggcttg
ctcgcacagcttgtcgccatgaatggcgtactcgagcaaattcaaaagtcactggatgaa
tatctcgagaccaagcgtcaagcctttcctcgcttctattttgtatccaatgatgacctt
ctcgagattcttgggcagtccaaaaatccgcctgccgtgcagccgcacttgctgaaatgc
tttgacaatgtcaagagtctggagttgcacaatgccgttgggcgcagccaggttcaagcg
ctgggcatgacctctgcagatgcagagtacgtgccgtttaagaccgctgttgccctggat
gggccagttgaggtctggctgacctctgtggagacagagatgcggcacactcttaagcag
ctgcttcaggaatgcatggtcgcgcatcgaaagcaaaagcgcgacaagtggcttaaggaa
tggcccggccagcttgttctcactgtgagtcaaatggcttggacatctgagtgcttcaag
gccatctctgacaagaaacacggggccaaagctggcctgaaagctatcaagaagaagcag
gtctcactcctcaacaagctgactgaggctgtgcgagccgtcaagaacaagacgcaacgc
aaaaagcttgtggcactcatcaccatcgaagtgcattcccgcgacgttatcgatcgcctc
ttgaaagtggcgaacatcgaccaaaatgcgtttgagtggctgatgcagctgcggttttac
tgggaaaagcctgaaaccggtcccagcgagggggagtgcatcatccgccaaaccaacacc
catttcagctatgggtacgagtattccggcaacagcggccgcctggtcattacgcctttg
acggaccgctgctacatgaccctgacgacggccttgcacttgaagcgcggtggctcgccc
aagggtccagctggtaccggcaagacggagacggtcaaggatcttggcaagtcactgggt
gattacgtcattgtcattaactgctctgacggcatggactacaagtcgcttggcgtcatg
ttccgcggtctagcacagactggcgcctggggttgttttgatgagttcaaccgcatcaac
atcgaagtgctttccgtcgtggcccagcagatcctctccatcctctcggctcagattccg
ctctcgccagagaacccgaagacacgcttcacgttcgagggcatggacatcaacctgctt
tggtcttgcggcatcttcatcaccatgaaccctggctatgccgggcgcaccgagttgcca
gataacctcaagtccatgttccgtccaatctccatgatgaagccagacacgcaacttatc
gccgagatcatcctctttggccagggtttcaacaacacgcgcgtgctcgccaagaaggct
gacactctgtacaagcttgcagctcagcagctgtccaagcaagaccactatgactatggt
cttcgcgccatggtctcaactctgttgtatgctggacgcaagcgtgaggcgatgcccgaa
atgccgcatgaggaggtgctgctgcttgccatgaaggacatgaacgtggccaagatgacg
ggcgctgacctgcctctgctccaacacatgatgtccgacctcttcccaggcgtggagacg
atggaggtggagtatggagccttccgcgaggccatcaaggcggatctggtcaagcagggc
tatcaagccaccccctggatgatcaccaaagccattcagctctttgagacgaaaaactcg
cgccactccgtcatgattgtcgggcgcactggctcaggcaagagtgttgcttggcacacg
ctgcagcgtgcaatgacgcagtgtgcacgcgacaacgtggagggctttgtacctgtgcgg
gagtacccgctcaatcccaaggcgctttccttggctgagctgtatggcgagttcaacatt
gccaccaacgagtggacggatggcgtgctctcctcggtgatgcgcaacgtctgctccgat
gagaagccagatcagaagtggattgtgtttgatggtcccgttgatacgctgtggattgag
agcatgaattcggtcatggacgacaacaagatcctgaccctcatcaacggtgatcgcatt
tccatgccggcgcaagtttcgctgctctttgaggttgaggatctggccgttgcgtcgccg
gcaaccgtgtcacgttgcggcatggtgtaccacgacacggctgacctcggctggcaaccc
tatgtcacttcgtggctcagtaatccgcgctttgaagcctatcgcggcccgctgcaggcc
cttttcgagaagtatgtcgaacgccttcttgattttgttcgccacaaatgcgaagaactc
gtggaaacctccctcctgagtcgggtgacgtccctgtgcaacctgctcgacgcctttttg
gtgcccgagaatggcatcgaccccgcggacaaggcccactttgcgcgtcttctggaacag
tggttcctctttgcttgtgtgtggtccctttgcgcgggcgtgaacgaggcaggtcgcaag
ttggttgacaatttcatccgtgagattgagggtcaattcccagccaaggacaccgtgtac
gagtactttgtggacgtgaagaatcacacttgggctcattgggagaaggagctttcggcg
gggtggaagtacgcccctgatgcaagttatcactcaattcaagtgcccacggtggacaca
gtgcgctacgagtttctgctgtccaacttgattgcacatcagcgcccgacgttgatggtg
ggtccagttggaacgggcaagacttcggtggtcgagcttgtcatggccaagctcgatgca
gcgcagtttaatcgcctaaccatcaacatgtcctcgcaaaccagctcaaacaacgtgcaa
gagatcattgagggccaggtggagaagcgtaccaagggtgtgtttgtgccccttgggggc
aagcagttgctcaccttcctggacgacctgaacatgccggccaaggatacttttggaagc
cagcccccgcttgaattgctgcgccagctcatggagtacgggttcatgtacgaccggcag
aaacaggtgttgaaacacatcaaggacatgcgagtcgtggcggccatgggtccgcccggg
ggcggccgctctgtcatcagccggcgccttcagagccgctttaacgtcatcaacatgacc
tttcccagccggtcgcagattcaacgcatctttggaaccatgatcaaccaaaagctacag
gattttgatgaggcgtgcaagccggtgggtgacatggtgaccaatggcaccattgacgtt
tatgagtacatgtctacgcgcatgctgcctacgccggccaaaatccactacctcttcaac
ttgcgcgatatttccaaggttttccagggtcttttgcgcgctcacaaggacgtacacgac
accaccgatgcgctgtcgcgcctgtgggtgcacgagtgctttcgcgtcttctgcgatcgc
ctcatcagctcttcggacgtggctgaattcaccaagcttattgaggacaagctgcacgag
cttttcaacatctcctactcgaccctttgccccaatcgcgtggtgcccgtctttgcggac
tttctgaaagccgaagacaatcccgtgtacgaggatgtgcgcgatccccaagtgctgcga
cgcgtgctgcaggagcgtttggacgagtacaatgaatcgggctttgttcccatggacctg
gttctgttccgtgatgccattgaacacgtgtgccgtgtcgtccgtgtcgtgcggtgtgag
cgtggcaacatgctgctcattggtgtcggtgggtctgggcggcagtcgctcacgcgcctc
gcctcgtacgtgctcgagtttaaggtgttccaaattgaggtcacgcggcagtaccgcatc
aacgaatttcgcgaggacctcaagacgctgtatcgacaagccggtcttgagaacaagccg
acagtcttcctctttactgacacacaaattgtcattgaagactttttggaggatatcaac
aacattttgagttccggcgaggttcccaacttgtttgcaccggatgagttggaggaaatt
cgcaatgagctggcaccgctggcgcgcaagcaaggtcttgacgagtcgccggtgggcctg
tacaagtatttcatcagccgtgttcgcaacaacctgcgcgttgtcctgtgcatgagcccc
gtcggcgaggctttccgcaaccgcctgcgcatgtaccccggccttgtcaactgtaccacc
atcgactactttcatgcatggcccgaagatgccctactcgccgtggcacaccgatacatg
cacgatgtggactttggcactggggaggacggcgaggccgtccgcaaggccgtctcatcc
acctttgccgttattcagcagtcggtcctgagctcttcggcccagatgctggaggaactc
aagcgacacaactatgtgacaccaaccaactacctcgagctcgtcatgggctacaagcag
ctcctggcggagaagcgccgcgagctgggcgatgctgccgacaagcttgccaatggcttg
ggcaagattgacgagacaagtgccaaggtagagcaaatgtccatcgagctggttgagacg
aagaagcaagtggccgagtttcagcgcgagtgtgaggagtacctcgtcatcattgtacag
cagaagcgcgaggccgacgatcagcagatggccgtgtcccagcgcagcgagaagattagc
gtggaggccaaacagtgtcagaagttggcttcggatgcgcaggccgaccttgacgaggcc
ctgccggctctggagagcgctatggaggcactcaactcgcttaataagggcgacatcacg
gagatcaagtcgtacagcaagccgcccgatctcgtggccatggtcatggaggctgtcatg
gttttgcgcaaatccaagccagactgggcggaagccaagcgtcaactgggtgacaccaat
tttatcaaccaactgattgagtttgacaaggacaacatgtctgagaagacgctgaaaaag
gtacgcacctacgttgtgcgcccagagtttgatccagatgtggtgggtcgcgtttcgaat
gcggcacgctcgctctgcatgtgggttcgggccatggatgtatatggccgcatcttcaag
gtcgtggaacccaagcgccaggccttgcaagcggcgcaaacggccctcaaggccaaggaa
gactcgttggcagaggccgaggccaagctgcgcgaggtgacggagaaggtggccaagctg
cagtctgattacgagagcaagcttcagaccaaggaagagctgcgcatcaagagtgaacag
acagagatcaagcttgagcgtgccgccaaactggtgtcgggcttggccggcgagcgctcg
cgctgggagcagagcgttggcgagctgcgacgcggcatcaaattcttggtgggtgattgc
ctcatgtgtgctggctttctctcatacctgggtccctttatcagcgagtaccgtgctcgc
attgtcgagcagtggcggcgccacattcgggacaacaacatcccttccgatcccgatttc
agcatgacaactctgttggcgaaggcaacagacgtgcgcttctggaacattcaaggcctg
ccgtccgaccaattcagcacggagaacggtgtgattgtgacacgcggccggcgctggcca
ctgatgattgaccctcagggacaggccatcaaatggatcaaaaacatggagcgcgaccgc
aagctgcaggtggtggacatgcaacaacctgactacattcgcacgctcgaaaacgccatc
cagtttggtacgccggtgctgatgcagaatgtgggcgaggagctggacccatccttggcc
cccgtgctgaacaaagcctttaccaaggtgggcgggcgcttgatgctcaagctcggggat
aaggagattgagtacaatccagactttcgcttctacttgacgaccaagatgagcaaccct
cactacactcccgagatctcgaccaagaccacgatcgtcaactttgcggtcgtccaacag
ggcttggaggcgcagctgctcggcattgtcgtgtccaaggagcgcccggagctggaaaag
caaaagaatgagctcgttctgaacattgccgcgggcaagaagaagctggtggacttggaa
gataagatcctgcagcttctgagctcggccaagggctcgcttctggacgacgaggagctg
gtcaacacgctgaacacctccaaggtcacctcggtggaggtgtcggagcaacttgtggtg
gcggaagcaacggagaaagagattgatgcggcacgtgagggttaccgtccgtccgcgtca
cgagcgtcggtgctcttctttgtgcttgatgatgtgtccaagattgaccctatgtaccaa
ttttcgctcgatgcttacatcaatctgtacacgctcagcatcgacaacagcgccaaggcg
ccagcgctcgaccagcgcatcgagagcatcaacgagtatcacaactatgcggtgtaccgt
tacacctgccgaggtctgtttgagaagcacaaactactctttgcgctgcacatgaatgcc
aagatcttggagagccagaacaagattgccttgggcgagtacaacttctttctacgcggc
ggtcaggtgctcgatcgcgacgcgcaggtgcccaaccccgcgcccggctggattacttca
gaggcttgggacaacgtgacggaaatggagcggctgctacccaagtttgcaggactgacg
gcttcgtttgagcagcagctgcgcgactggcaggcgtggtatgtgcatcccgaaccggag
acggcgccactgccaggggaatggcaggccacctgcaatgagctgcagcgcatgtgcatt
gtgcgggcgctgcgcccggaccgcgtggcaattgttgccatccagtacattgtcaacaac
ctgggccagcgcttcgtggagccaccaccacttgacatgaacgccgtgttggcggattcc
aatgccatgacgccactcatctttgttctatctgtgggcgtggatccgacgaagcagctg
ctggatcttgctgaacgctccggtatgagcgaccgctttcacagcctgtctctcggtcaa
gggcaggcaccaattgcggagcgcctcattgccgagggtgcttcgcgtggtgactgggtg
ttcctggcgaattgtcacctctccttgagctggatgccctccctgagtaagctggtggag
ctgctggagtcacagcagccgcaccccgactttcggctgtggctcagctccaagccggac
ccgcgcttcccgatttcgattttgcaggcgggtatcaagatgacaacggaaccaccaaat
ggtatcaaggcgaacatgaagcggctgtacaacaccatcagcgaggagcagtttgagcgc
tgcaacgcttcgtccaagtacaagaaactgatgttttccctgacctttttccacagcatc
ttgctcgagcgtcgcaagttccaaatgctgggctggaacgtgcaataccccttcaacgac
tcggactttgaggtttcggagaacctgctggcgctcttcctggacgagtatgaggagaca
ccgtgggagtcactcaagtacctgattgcgggcatcaactacggtggccacgtgacagat
gactgggatcgacgcctcttgctgacctacattaacgagctgttcagtgatcaggtgttg
caggtggaggcgtgcccggtgtcggccagcccgctctactttgtgcctccagatggccca
ttgcagtcatacaaggattacatcaacacgctgccaggcgtggacccccccaccgctttt
gggcaaaatgccaacgcggatatctcaagcatgatccgggaagcccgcacgttgctgggc
acgctggtgtccatgcagccagccgtcagcgccaaagagggtggtagtcgggaggacaag
gttttggagctggcgcgggacatgctggcgcggctacccaagaccatcgattacgaggcg
acggccaagctcttggcggctgatccgcgtccgttgaacattgtgttgctgcaggagatc
cagcgatacaaccgattgctggaggcgatgcgcgtcaacctggtcgacctcgatcacggt
atccagggactggtggtgatgagtcacgagctggagcagattttcgagtgcatctatcag
ggcgaggtgccggtagcttggaaagcaacgtacccgtcccaaaagccgttggcctcgtgg
atgcgcgacttggtggagcggattgaatttctgacgcagtgggcagtcacgggtcgccag
ccccttatcttctggatgtcggcctttagcttcccgacgggctttctcacggctgtgctg
cagcaagcggcgcgctccaacggcgtgtcaatcgacacgctctcatgggagttttcggtc
atgaccgtcgatgacgtcaacattgtggaggagccgagggacggtgtctacgtgcgtgga
ctcttcctcgagggtgcggggtgggataagcgcaatgcttgccttgtggaggcggaggcc
atgcagctggtcagcagcatgcccacgatccacttcaaacccgttgagaacaagaaggtc
gccaagaaaggcagctatgcttgtccctgctattactatcccaaccgcacgggcgaaggc
ggtgcgtctgcatggtcctttgtcatttcggtggacctcaagaccggtgatctgccccct
gaacactgggtcaagcgtggcaccgcactgctgatgagcttggacagttag

DBGET integrated database retrieval system