KEGG   Monosiga brevicollis: MONBRDRAFT_20766
Entry
MONBRDRAFT_20766  CDS       T01042                                 
Name
(RefSeq) hypothetical protein
  KO
K18050  novel protein kinase C epsilon type [EC:2.7.11.13]
Organism
mbr  Monosiga brevicollis
Brite
KEGG Orthology (KO) [BR:mbr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mbr01001]
    MONBRDRAFT_20766
Enzymes [BR:mbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     MONBRDRAFT_20766
Protein kinases [BR:mbr01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   MONBRDRAFT_20766
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 Pkinase_C ABC1 C1_2 Kinase-like DUF4554 APH PHD
Other DBs
NCBI-GeneID: 5890562
NCBI-ProteinID: XP_001745150
JGI: 20766
UniProt: A9UXQ2
AA seq 561 aa
MADQPLEFVERDEAPRRKGAFKRRKVHEINRHKFVARFFRQPTYCSHCKGFCWGLGKQGY
ECLNCRMAVHKKCHALVISPCPGAEMQMESIRRTNEEMQLRFNVNVPHRFKVKTYKSPTF
CDHCGSLLWGLYNQGMQCVSCKTNVHKRCAPHTPHLCGLDHMRLAAELMKIDLTADKMRN
SQRSEDESEDGSEASSKSKAELRAEAKALRKADKERKREEKKASSSAHSNDDLSPDAFKF
LKVLGKGSFGKVMLAEHKKTKQIFAVKLLKKDVLVEDDDVECAISEKRVLTFTGQHPFLT
RMYCCFQTPGHLFYVMEYIAGGDLLFQIQHARRFKEERARFYAAEIALGLLFLHRRNIAY
RDLKLDNVMLDAEGHIKIADFGMCKDTADEPARTFCGTLDYIAPEIIKEVPYDYKVDWWA
LGVLLYEMLAGQPPFDGASEDDLFMAILHNEVLFPVWLSKDAVSIIRGFLTKDRDQRLGC
GPNGEADIKAHSFFRGIDWVKLEKKEIEPPFKPKIKGDRAVDNFDQEFLREKPVVTPPDP
NRVKHIPQDEFANFTFIEPGF
NT seq 1683 nt   +upstreamnt  +downstreamnt
atggctgatcaacccctcgagtttgtggagcgcgatgaggcgccccgccgcaagggtgcc
ttcaagcgccgtaaggttcacgagatcaaccgtcacaaatttgtcgcccgcttcttccgt
cagcccacctactgctcccattgcaaagggttttgctggggtctgggcaaacaaggctat
gaatgcctcaactgtcgcatggccgtgcacaaaaagtgccatgcccttgtcatcagcccc
tgccccggcgcggagatgcaaatggagagcattcgccgcaccaacgaggaaatgcaattg
cgattcaacgttaacgtcccacaccgcttcaaggtcaagacgtacaagagtcccacgttt
tgtgatcactgcggcagcttgctctggggcctgtacaaccagggcatgcaatgcgtttcc
tgcaagaccaacgtccacaagcgctgcgccccccacacgcctcatttgtgcggcctggac
cacatgcgtctggcagccgagctcatgaagattgatctgacagccgacaagatgcgcaac
tcgcaacgctcggaggacgaaagcgaggatggcagcgaggcctcatccaaaagcaaggcc
gagctccgcgctgaagccaaggccctgcgcaaagcagacaaagagcgcaagcgcgaggag
aagaaggcttccagttctgctcacagcaacgacgacctgtcacctgatgccttcaagttt
ctcaaggtcctgggcaagggctctttcggcaaggtcatgctggctgagcacaagaagacg
aaacaaatttttgccgtcaaacttttgaagaaggacgtcctggtggaggatgacgacgtg
gagtgtgccatctctgagaaacgtgtcctcacatttaccgggcagcacccctttctgacc
cgcatgtattgctgctttcaaacccccggccacctcttttacgttatggagtacattgcc
ggcggtgacttgctcttccaaattcagcacgctcgacgattcaaggaggaacgtgctcgc
ttttatgctgccgaaattgctcttggcctcctcttcctgcacaggcggaacattgcttac
cgcgacctcaagctcgacaacgtcatgcttgacgccgagggccacatcaagattgccgac
tttggaatgtgcaaagacacggccgatgagcccgcccgcactttttgcggcacgctcgac
tacattgcccccgagattatcaaggaggtgccctacgactacaaggttgattggtgggcg
ctgggtgtcttgttgtacgagatgctggccggtcagcccccctttgacggtgccagcgag
gacgacctcttcatggccatcctccacaacgaggttctcttccccgtctggctctcgaag
gacgccgtgtccatcattcgagggttcttgaccaaggaccgcgatcagcgcctgggctgc
ggcccgaatggtgaagccgacatcaaggctcactccttcttccgtggtattgactgggtc
aaactcgagaagaaggaaatcgagccccccttcaagcccaagatcaagggtgatcgtgcg
gttgacaactttgaccaagaatttcttcgagaaaagcccgtggttacacccccggacccc
aaccgggtcaagcacatccctcaggatgagtttgccaactttacatttatcgagcctggc
ttt

DBGET integrated database retrieval system